+ USE_DATABASE_REPLICATED=0 + USE_SHARED_CATALOG=0 ++ rg -v '#' /usr/share/zoneinfo/zone.tab ++ awk '{print $3}' ++ shuf ++ head -n1 + TZ=Pacific/Kiritimati + echo 'Chosen random timezone Pacific/Kiritimati' + ln -snf /usr/share/zoneinfo/Pacific/Kiritimati /etc/localtime Chosen random timezone Pacific/Kiritimati + echo Pacific/Kiritimati + dpkg -i package_folder/clickhouse-common-static_24.8.14.10526.altinitytest_amd64.deb Selecting previously unselected package clickhouse-common-static. (Reading database ... 48426 files and directories currently installed.) Preparing to unpack .../clickhouse-common-static_24.8.14.10526.altinitytest_amd64.deb ... Unpacking clickhouse-common-static (24.8.14.10526.altinitytest) ... Setting up clickhouse-common-static (24.8.14.10526.altinitytest) ... + dpkg -i package_folder/clickhouse-common-static-dbg_24.8.14.10526.altinitytest_amd64.deb Selecting previously unselected package clickhouse-common-static-dbg. (Reading database ... 48453 files and directories currently installed.) Preparing to unpack .../clickhouse-common-static-dbg_24.8.14.10526.altinitytest_amd64.deb ... Unpacking clickhouse-common-static-dbg (24.8.14.10526.altinitytest) ... Setting up clickhouse-common-static-dbg (24.8.14.10526.altinitytest) ... + dpkg -i package_folder/clickhouse-odbc-bridge_24.8.14.10526.altinitytest_amd64.deb Selecting previously unselected package clickhouse-odbc-bridge. (Reading database ... 48460 files and directories currently installed.) Preparing to unpack .../clickhouse-odbc-bridge_24.8.14.10526.altinitytest_amd64.deb ... Unpacking clickhouse-odbc-bridge (24.8.14.10526.altinitytest) ... Setting up clickhouse-odbc-bridge (24.8.14.10526.altinitytest) ... + dpkg -i package_folder/clickhouse-library-bridge_24.8.14.10526.altinitytest_amd64.deb Selecting previously unselected package clickhouse-library-bridge. (Reading database ... 48466 files and directories currently installed.) Preparing to unpack .../clickhouse-library-bridge_24.8.14.10526.altinitytest_amd64.deb ... Unpacking clickhouse-library-bridge (24.8.14.10526.altinitytest) ... Setting up clickhouse-library-bridge (24.8.14.10526.altinitytest) ... + dpkg -i package_folder/clickhouse-server_24.8.14.10526.altinitytest_amd64.deb Selecting previously unselected package clickhouse-server. (Reading database ... 48472 files and directories currently installed.) Preparing to unpack .../clickhouse-server_24.8.14.10526.altinitytest_amd64.deb ... Unpacking clickhouse-server (24.8.14.10526.altinitytest) ... Setting up clickhouse-server (24.8.14.10526.altinitytest) ... ClickHouse binary is already located at /usr/bin/clickhouse Symlink /usr/bin/clickhouse-server already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-server to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-client to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-local to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-benchmark to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-obfuscator to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-git-import to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-compressor to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-format to /usr/bin/clickhouse. Symlink /usr/bin/clickhouse-extract-from-config already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-extract-from-config to /usr/bin/clickhouse. Symlink /usr/bin/clickhouse-keeper already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-keeper to /usr/bin/clickhouse. Symlink /usr/bin/clickhouse-keeper-converter already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-keeper-converter to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-disks to /usr/bin/clickhouse. Creating symlink /usr/bin/ch to /usr/bin/clickhouse. Creating symlink /usr/bin/chl to /usr/bin/clickhouse. Creating symlink /usr/bin/chc to /usr/bin/clickhouse. Creating clickhouse group if it does not exist. groupadd -r clickhouse Creating clickhouse user if it does not exist. useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse clickhouse Will set ulimits for clickhouse user in /etc/security/limits.d/clickhouse.conf. Creating config directory /etc/clickhouse-server/config.d that is used for tweaks of main server configuration. Creating config directory /etc/clickhouse-server/users.d that is used for tweaks of users configuration. Config file /etc/clickhouse-server/config.xml already exists, will keep it and extract path info from it. /etc/clickhouse-server/config.xml has /var/lib/clickhouse/ as data path. /etc/clickhouse-server/config.xml has /var/log/clickhouse-server/ as log path. Users config file /etc/clickhouse-server/users.xml already exists, will keep it and extract users info from it. Log directory /var/log/clickhouse-server/ already exists. Creating data directory /var/lib/clickhouse/. Creating pid directory /var/run/clickhouse-server. chown -R clickhouse:clickhouse '/var/log/clickhouse-server/' chown -R clickhouse:clickhouse '/var/run/clickhouse-server' chown clickhouse:clickhouse '/var/lib/clickhouse/' groupadd -r clickhouse-bridge useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse-bridge clickhouse-bridge chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-odbc-bridge' chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-library-bridge' Password for the default user is an empty string. See /etc/clickhouse-server/users.xml and /etc/clickhouse-server/users.d to change it. Setting capabilities for clickhouse binary. This is optional. chown -R clickhouse:clickhouse '/etc/clickhouse-server' ClickHouse has been successfully installed. Start clickhouse-server with: sudo clickhouse start Start clickhouse-client with: clickhouse-client + dpkg -i package_folder/clickhouse-client_24.8.14.10526.altinitytest_amd64.deb Selecting previously unselected package clickhouse-client. (Reading database ... 48489 files and directories currently installed.) Preparing to unpack .../clickhouse-client_24.8.14.10526.altinitytest_amd64.deb ... Unpacking clickhouse-client (24.8.14.10526.altinitytest) ... Setting up clickhouse-client (24.8.14.10526.altinitytest) ... + echo '' + [[ -z '' ]] + ch --query 'SELECT 1' 1 + chl --query 'SELECT 1' 1 + chc --version ClickHouse client version 24.8.14.10526.altinitytest (altinity build). + ln -s /usr/share/clickhouse-test/clickhouse-test /usr/bin/clickhouse-test + source /attach_gdb.lib ++ source /utils.lib +++ sysctl kernel.core_pattern=core.%e.%p-%P kernel.core_pattern = core.%e.%p-%P +++ sysctl fs.suid_dumpable=1 fs.suid_dumpable = 1 + source /utils.lib ++ sysctl kernel.core_pattern=core.%e.%p-%P kernel.core_pattern = core.%e.%p-%P ++ sysctl fs.suid_dumpable=1 fs.suid_dumpable = 1 + /usr/share/clickhouse-test/config/install.sh + DEST_SERVER_PATH=/etc/clickhouse-server + DEST_CLIENT_PATH=/etc/clickhouse-client +++ dirname /usr/share/clickhouse-test/config/install.sh ++ cd /usr/share/clickhouse-test/config ++ pwd -P + SRC_PATH=/usr/share/clickhouse-test/config + echo 'Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server' Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server + mkdir -p /etc/clickhouse-server/config.d/ + mkdir -p /etc/clickhouse-server/users.d/ + mkdir -p /etc/clickhouse-client + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_write.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/max_num_to_warn.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/listen.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/text_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/blob_storage_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/custom_settings_prefixes.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/database_catalog_drop_table_concurrency.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_access_control_improvements.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/macros.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/secure_ports.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/clusters.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/graphite.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/graphite_alternative.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/grpc_protocol.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/database_atomic.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/max_concurrent_queries.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_settings.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/backoff_failed_mutation.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_old_dirs_cleanup.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/test_cluster_with_incorrect_pw.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/keeper_port.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/logging_no_rotate.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/lost_forever_check.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/tcp_with_proxy.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/prometheus.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_lists.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/transactions.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/encryption.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/CORS.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/logger_trace.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/named_collection.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/ssl_certs.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_cache_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/session_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/system_unfreeze.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_zero_copy_replication.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/nlp.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/forbidden_headers.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_keeper_map.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/custom_disks_base_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/display_name.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/compressed_marks_and_index.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/disable_s3_env_credentials.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_wait_for_shutdown_replicated_tables.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/backups.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_caches_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/validate_tcp_client_information.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/zero_copy_destructive_operations.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/block_number.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/handlers.yaml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/serverwide_trace_collector.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/rocksdb.xml /etc/clickhouse-server/config.d/ + '[' /etc/clickhouse-server = /etc/clickhouse-server ']' + ln -sf /usr/share/clickhouse-test/config/config.d/legacy_geobase.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/log_queries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/readonly.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/access_management.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/database_atomic_drop_detach_sync.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/opentelemetry.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/remote_queries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/session_log_test.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/memory_profiler.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/no_fsync_metadata.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/filelog.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/enable_blobs_check.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/marks.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/insert_keeper_retries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/prefetch_settings.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/nonconst_timezone.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/allow_introspection_functions.yaml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/replicated_ddl_entry.xml /etc/clickhouse-server/users.d/ + [[ -n '' ]] + ln -sf /usr/share/clickhouse-test/config/users.d/timeouts.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/ints_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/strings_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/decimals_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/executable_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/executable_pool_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/test_function.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/top_level_domains /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/regions_hierarchy.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/regions_names_en.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/ext-en.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/ext-ru.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/lem-en.bin /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/server.key /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/server.crt /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/dhparam.pem /etc/clickhouse-server/ + ln -sf --backup=simple --suffix=_original.xml /usr/share/clickhouse-test/config/config.d/query_masking_rules.xml /etc/clickhouse-server/config.d/ + [[ -n '' ]] + rm -f /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper.xml /etc/clickhouse-server/config.d/ + [[ -n '' ]] + rm -f /etc/clickhouse-server/config.d/cannot_allocate_thread_injection.xml + value=1 + sed --follow-symlinks -i 's|[01]|1|' /etc/clickhouse-server/config.d/keeper_port.xml + value=44509184 + sed --follow-symlinks -i 's|[[:digit:]]\+|44509184|' /etc/clickhouse-server/config.d/keeper_port.xml + value=29480960 + sed --follow-symlinks -i 's|[[:digit:]]\+|29480960|' /etc/clickhouse-server/config.d/keeper_port.xml + [[ -n '' ]] + [[ -n '' ]] + [[ '' == \1 ]] + [[ '' == \1 ]] + [[ -n 1 ]] + ln -sf /usr/share/clickhouse-test/config/config.d/azure_storage_conf.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02944.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02963.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02961.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache_new.xml /etc/clickhouse-server/users.d/ + [[ -n 0 ]] + [[ 0 -eq 1 ]] + ln -sf /usr/share/clickhouse-test/config/client_config.xml /etc/clickhouse-client/config.xml + [[ -n 0 ]] + [[ 0 -eq 1 ]] + ./setup_minio.sh stateless + azurite-blob --blobHost 0.0.0.0 --blobPort 10000 --debug /azurite_log + export MINIO_ROOT_USER=clickhouse + MINIO_ROOT_USER=clickhouse + export MINIO_ROOT_PASSWORD=clickhouse + MINIO_ROOT_PASSWORD=clickhouse + main stateless + local query_dir ++ check_arg stateless ++ local query_dir ++ '[' '!' 1 -eq 1 ']' ++ case "$1" in ++ query_dir=0_stateless ++ echo 0_stateless + query_dir=0_stateless + '[' '!' -f ./minio ']' + start_minio + mkdir -p ./minio_data + ./minio --version minio version RELEASE.2024-08-03T04-33-23Z (commit-id=6efb56851c40da88d1ca15112e2d686a4ecec6b3) Runtime: go1.22.5 linux/amd64 License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html Copyright: 2015-2024 MinIO, Inc. + wait_for_it + ./minio server --address :11111 ./minio_data + local counter=0 + local max_counter=60 + local url=http://localhost:11111 + params=('--silent' '--verbose') + local params + grep AccessDenied + curl --silent --verbose http://localhost:11111 + [[ 0 == \6\0 ]] + echo 'trying to connect to minio' + sleep 1 trying to connect to minio Azurite Blob service is starting on 0.0.0.0:10000 Azurite Blob service successfully listens on http://0.0.0.0:10000 INFO: Formatting 1st pool, 1 set(s), 1 drives per set. INFO: WARNING: Host local has more than 0 drives of set. A host failure will result in data becoming unavailable. MinIO Object Storage Server Copyright: 2015-2026 MinIO, Inc. License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/amd64) API: http://172.17.0.2:11111 http://127.0.0.1:11111 WebUI: http://172.17.0.2:37561 http://127.0.0.1:37561 Docs: https://min.io/docs/minio/linux/index.html + counter=1 + curl --silent --verbose http://localhost:11111 + grep AccessDenied AccessDeniedAccess Denied./189DF9D873B77B867dc7eb22d3288ec80374614e9088e31d3668a6922ead55932dd2a8e56373820f + lsof -i :11111 COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME minio 294 root 6u IPv4 38071 0t0 TCP localhost:11111 (LISTEN) minio 294 root 10u IPv6 38072 0t0 TCP *:11111 (LISTEN) minio 294 root 11u IPv6 38073 0t0 TCP localhost:11111 (LISTEN) + sleep 5 + setup_minio stateless + local test_type=stateless + ./mc alias set clickminio http://localhost:11111 clickhouse clickhouse Added `clickminio` successfully. + ./mc admin user add clickminio test testtest Added user `test` successfully. + ./mc admin policy attach clickminio readwrite --user=test Attached Policies: [readwrite] To User: test + ./mc mb --ignore-existing clickminio/test Bucket created successfully `clickminio/test`. + '[' stateless = stateless ']' + ./mc anonymous set public clickminio/test Access permission for `clickminio/test` is set to `public` + upload_data 0_stateless /usr/share/clickhouse-test + local query_dir=0_stateless + local test_path=/usr/share/clickhouse-test + local data_path=/usr/share/clickhouse-test/queries/0_stateless/data_minio + '[' -d /usr/share/clickhouse-test/queries/0_stateless/data_minio ']' + ./mc cp --recursive /usr/share/clickhouse-test/queries/0_stateless/data_minio/ clickminio/test/ `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.tar` -> `clickminio/test/03036_archive1.tar` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.arrow` -> `clickminio/test/02731.arrow` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.parquet` -> `clickminio/test/02731.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02366_data.jsonl` -> `clickminio/test/02366_data.jsonl` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02876.parquet` -> `clickminio/test/02876.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.zip` -> `clickminio/test/03036_archive1.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.tar` -> `clickminio/test/03036_archive2.tar` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.zip` -> `clickminio/test/03036_archive2.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive3.tar.gz` -> `clickminio/test/03036_archive3.tar.gz` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_compressed_file_archive.zip` -> `clickminio/test/03036_compressed_file_archive.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_json_archive.zip` -> `clickminio/test/03036_json_archive.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/a.tsv` -> `clickminio/test/a.tsv` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/b.tsv` -> `clickminio/test/b.tsv` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/c.tsv` -> `clickminio/test/c.tsv` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/non_existing_column=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/non_existing_column=Elizabeth/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/json_data` -> `clickminio/test/json_data` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/tsv_with_header.tsv` -> `clickminio/test/tsv_with_header.tsv` Total: 5.42 MiB, Transferred: 5.42 MiB, Speed: 102.04 MiB/s + setup_aws_credentials + local minio_root_user=clickhouse + local minio_root_password=clickhouse + mkdir -p /root/.aws + cat + ./setup_hdfs_minicluster.sh + ls -lha total 125M drwxr-xr-x 1 root root 4.0K Mar 19 05:42 . drwxr-xr-x 1 root root 4.0K Mar 19 05:42 .. -rw-rw-r-- 1 1000 1000 119 Mar 19 05:33 analyzer_tech_debt.txt -rw-rw-r-- 1 root root 2.4K Feb 1 2025 attach_gdb.lib -rw-r--r-- 1 root root 1.3K Mar 19 05:42 __azurite_db_blob_extent__.json -rw-r--r-- 1 root root 3.9K Mar 19 05:42 __azurite_db_blob__.json -rw-r--r-- 1 root root 1.4K Mar 19 05:42 azurite_log lrwxrwxrwx 1 root root 7 Sep 12 2024 bin -> usr/bin drwxr-xr-x 2 root root 4.0K Mar 19 05:42 __blobstorage__ drwxr-xr-x 2 root root 4.0K Apr 19 2022 boot -rw-rw-r-- 1 1000 1000 966 Mar 19 05:33 broken_tests.json drwxr-xr-x 14 root root 3.8K Mar 19 05:41 dev -rwxr-xr-x 1 root root 0 Mar 19 05:41 .dockerenv drwxr-xr-x 1 root root 4.0K Mar 19 05:42 etc drwxr-xr-x 10 1000 1000 4.0K Jun 15 2021 hadoop-3.3.1 drwxr-xr-x 2 root root 4.0K Apr 19 2022 home lrwxrwxrwx 1 root root 7 Sep 12 2024 lib -> usr/lib lrwxrwxrwx 1 root root 9 Sep 12 2024 lib32 -> usr/lib32 lrwxrwxrwx 1 root root 9 Sep 12 2024 lib64 -> usr/lib64 lrwxrwxrwx 1 root root 10 Sep 12 2024 libx32 -> usr/libx32 -rwxr-xr-x 1 root root 26M Feb 1 2025 mc drwxr-xr-x 2 root root 4.0K Sep 12 2024 media -rwxr-xr-x 1 root root 99M Feb 1 2025 minio drwxr-xr-x 4 root root 4.0K Mar 19 05:42 minio_data drwxr-xr-x 2 root root 4.0K Sep 12 2024 mnt drwxr-xr-x 1 root root 4.0K Feb 1 2025 opt -rw-r--r-- 1 root root 0 Feb 15 2024 .package-cache-mutate drwxrwxr-x 2 1000 1000 4.0K Mar 19 05:41 package_folder dr-xr-xr-x 310 root root 0 Mar 19 05:41 proc -rwxrwxr-x 1 root root 9.5K Feb 1 2025 process_functional_tests_result.py -rw-rw-r-- 1 root root 837 Feb 1 2025 requirements.txt drwx------ 1 root root 4.0K Mar 19 05:42 root drwxr-xr-x 1 root root 4.0K Mar 19 05:42 run -rwxrwxr-x 1 root root 22K Feb 1 2025 run.sh lrwxrwxrwx 1 root root 8 Sep 12 2024 sbin -> usr/sbin -rwxrwxr-x 1 root root 11K Feb 1 2025 setup_export_logs.sh -rwxrwxr-x 1 root root 360 Feb 1 2025 setup_hdfs_minicluster.sh -rwxrwxr-x 1 root root 3.4K Feb 1 2025 setup_minio.sh drwxr-xr-x 2 root root 4.0K Sep 12 2024 srv -rw-rw-r-- 1 root root 14K Feb 1 2025 stress_tests.lib dr-xr-xr-x 13 root root 0 Mar 19 05:41 sys drwxrwxr-x 2 1000 1000 4.0K Mar 19 05:41 test_output drwxrwxrwt 1 root root 4.0K Feb 1 2025 tmp drwxr-xr-x 1 root root 4.0K Sep 12 2024 usr -rw-rw-r-- 1 root root 897 Feb 1 2025 utils.lib drwxr-xr-x 1 root root 4.0K Sep 12 2024 var + cd hadoop-3.3.1 + export JAVA_HOME=/usr + JAVA_HOME=/usr + mkdir -p target/test/data + chown clickhouse ./target/test/data + nc -z localhost 12222 + sudo -E -u clickhouse bin/mapred minicluster -format -nomr -nnport 12222 + sleep 1 + nc -z localhost 12222 + sleep 1 + nc -z localhost 12222 + lsof -i :12222 COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME java 420 clickhouse 322u IPv4 24541 0t0 TCP localhost:12222 (LISTEN) java 420 clickhouse 544u IPv4 27473 0t0 TCP localhost:51892->localhost:12222 (ESTABLISHED) java 420 clickhouse 545u IPv4 37618 0t0 TCP localhost:12222->localhost:51892 (ESTABLISHED) + sleep 5 + config_logs_export_cluster /etc/clickhouse-server/config.d/system_logs_export.yaml + set +x File /tmp/export-logs-config.sh does not exist, do not setup + [[ -n '' ]] + export IS_FLAKY_CHECK=0 + IS_FLAKY_CHECK=0 + '[' 1 -gt 1 ']' + sudo -E -u clickhouse /usr/bin/clickhouse-server --config /etc/clickhouse-server/config.xml --daemon --pid-file /var/run/clickhouse-server/clickhouse-server.pid + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for _ in {1..100} + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + sleep 1 127.0.0.1 - - [18/Mar/2026:15:42:30 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 404 - 127.0.0.1 - - [18/Mar/2026:15:42:30 +0000] "PUT /devstoreaccount1/cont?restype=container HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:15:42:30 +0000] "PUT /devstoreaccount1/cont/acormjlbtzavbauuopexhkjgeyvdrxmn HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:15:42:30 +0000] "GET /devstoreaccount1/cont/acormjlbtzavbauuopexhkjgeyvdrxmn HTTP/1.1" 206 4 127.0.0.1 - - [18/Mar/2026:15:42:30 +0000] "GET /devstoreaccount1/cont/acormjlbtzavbauuopexhkjgeyvdrxmn HTTP/1.1" 206 2 127.0.0.1 - - [18/Mar/2026:15:42:30 +0000] "DELETE /devstoreaccount1/cont/acormjlbtzavbauuopexhkjgeyvdrxmn HTTP/1.1" 202 - + for _ in {1..100} + clickhouse-client --query 'SELECT 1' 1 + break + setup_logs_replication + set +x File /tmp/export-logs-config.sh does not exist, do not setup + attach_gdb_to_clickhouse ++ run_with_retry 5 clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ [[ ahxB =~ e ]] ++ set_e=false ++ set +e ++ local total_retries=5 ++ shift ++ local retry=0 ++ '[' 0 -ge 5 ']' ++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ false ++ return + IS_ASAN=0 + [[ 0 = \1 ]] ++ kill -l SIGRTMIN + RTMIN=34 + echo ' set follow-fork-mode parent handle SIGHUP nostop noprint pass handle SIGINT nostop noprint pass handle SIGQUIT nostop noprint pass handle SIGPIPE nostop noprint pass handle SIGTERM nostop noprint pass handle SIGUSR1 nostop noprint pass handle SIGUSR2 nostop noprint pass handle SIG34 nostop noprint pass info signals continue backtrace full info registers p top' 1 KiB of the 'stack: p/x *(uint64_t[128]*)$sp maintenance info sections thread apply all backtrace full disassemble /s up disassemble /s up disassemble /s p "done" detach quit ' + sleep 5 + ts '%Y-%m-%d %H:%M:%S' ++ cat /var/run/clickhouse-server/clickhouse-server.pid + gdb -batch -command script.gdb -p 606 + run_with_retry 60 clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' + [[ aehxB =~ e ]] + set_e=true + set +e + local total_retries=60 + shift + local retry=0 + '[' 0 -ge 60 ']' + clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' Connected to clickhouse-server after attaching gdb + true + set -e + return + clickhouse-client --query 'CREATE TABLE minio_audit_logs ( log String, event_time DateTime64(9) MATERIALIZED parseDateTime64BestEffortOrZero(trim(BOTH '\''"'\'' FROM JSONExtractRaw(log, '\''time'\'')), 9, '\''UTC'\'') ) ENGINE = MergeTree ORDER BY tuple()' + clickhouse-client --query 'CREATE TABLE minio_server_logs ( log String, event_time DateTime64(9) MATERIALIZED parseDateTime64BestEffortOrZero(trim(BOTH '\''"'\'' FROM JSONExtractRaw(log, '\''time'\'')), 9, '\''UTC'\'') ) ENGINE = MergeTree ORDER BY tuple()' + ./mc admin config set clickminio logger_webhook:ch_server_webhook 'endpoint=http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_server_logs%20FORMAT%20LineAsString' queue_size=1000000 batch_size=500 Successfully applied new settings. + ./mc admin config set clickminio audit_webhook:ch_audit_webhook 'endpoint=http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString' queue_size=1000000 batch_size=500 Successfully applied new settings. + max_retries=100 + retry=1 clickminio restart attempt 1: + '[' 1 -le 100 ']' + echo 'clickminio restart attempt 1:' ++ ./mc admin service restart clickminio --wait --json ++ jq -r .status INFO: Restarting on service signal MinIO Object Storage Server Copyright: 2015-2026 MinIO, Inc. License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/amd64) API: http://172.17.0.2:11111 http://127.0.0.1:11111 WebUI: http://172.17.0.2:42833 http://127.0.0.1:42833 Docs: https://min.io/docs/minio/linux/index.html + output='success success' + echo 'Output of restart status: success success' + expected_output='success success' + '[' 'success success' = 'success success' ']' + echo 'Restarted clickminio successfully.' + break + '[' 1 -gt 100 ']' Output of restart status: success success Restarted clickminio successfully. + MC_ADMIN_PID=1491 + ./mc admin trace clickminio + export -f run_tests + '[' 1 -gt 1 ']' + run_tests + set -x + read -ra ADDITIONAL_OPTIONS + HIGH_LEVEL_COVERAGE=YES + '[' 1 -gt 1 ']' + [[ -n '' ]] + [[ -n '' ]] + [[ 0 -eq 1 ]] + [[ '' -eq 1 ]] + [[ 0 -eq 1 ]] ++ clickhouse-client --query 'SELECT value LIKE '\''%SANITIZE_COVERAGE%'\'' FROM system.build_options WHERE name = '\''CXX_FLAGS'\''' + [[ 1 == 0 ]] + ADDITIONAL_OPTIONS+=('--jobs') + ADDITIONAL_OPTIONS+=('8') + [[ -n 0 ]] + [[ -n 2 ]] + ADDITIONAL_OPTIONS+=('--run-by-hash-num') + ADDITIONAL_OPTIONS+=("$RUN_BY_HASH_NUM") + ADDITIONAL_OPTIONS+=('--run-by-hash-total') + ADDITIONAL_OPTIONS+=("$RUN_BY_HASH_TOTAL") + HIGH_LEVEL_COVERAGE=NO + [[ -n '' ]] + [[ NO = \Y\E\S ]] + ADDITIONAL_OPTIONS+=('--report-logs-stats') + try_run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')' + local total_retries=10 + shift + fn_exists run_with_retry + declare -F run_with_retry + run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')' + [[ aehxB =~ e ]] + set_e=true + set +e + local total_retries=10 + shift + local retry=0 + '[' 0 -ge 10 ']' + clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')' + true + set -e + return + set +e + TEST_ARGS=(--testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --no-drop-if-fail --capture-client-stacktrace --test-runs "$NUM_TRIES" "${ADDITIONAL_OPTIONS[@]}") + clickhouse-test --testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --no-drop-if-fail --capture-client-stacktrace --test-runs 1 --hung-check --print-time --jobs 8 --run-by-hash-num 0 --run-by-hash-total 2 --report-logs-stats + ts '%Y-%m-%d %H:%M:%S' + tee -a test_output/test_result.txt 2026-03-19 05:42:47 Using queries from '/usr/share/clickhouse-test/queries' directory 2026-03-19 05:42:47 Connecting to ClickHouse server... OK 2026-03-19 05:42:47 Connected to server 24.8.14.10526.altinitytest @ ff09016dd33d410d3b6de85846f3def6973b3995 HEAD 2026-03-19 05:42:47 Found 3254 parallel tests and 282 sequential tests 2026-03-19 05:42:48 Running about 406 stateless tests (Process-5). 2026-03-19 05:42:48 02095_function_get_os_kernel_version: [ OK ] 0.32 sec. 2026-03-19 05:42:48 Running about 406 stateless tests (Process-8). 2026-03-19 05:42:48 02494_array_function_range: [ OK ] 0.32 sec. 2026-03-19 05:42:48 Running about 406 stateless tests (Process-6). 2026-03-19 05:42:48 02354_vector_search_queries: [ OK ] 0.42 sec. 2026-03-19 05:42:48 Running about 406 stateless tests (Process-7). 2026-03-19 05:42:48 03047_analyzer_alias_join: [ OK ] 0.42 sec. 2026-03-19 05:42:48 Running about 406 stateless tests (Process-3). 2026-03-19 05:42:48 01825_type_json_5: [ OK ] 0.47 sec. 2026-03-19 05:42:48 01458_named_tuple_millin: [ OK ] 0.27 sec. 2026-03-19 05:42:48 02956_fix_to_start_of_milli_microsecond: [ OK ] 0.32 sec. 2026-03-19 05:42:48 Running about 406 stateless tests (Process-10). 2026-03-19 05:42:48 02792_alter_table_modify_comment: [ OK ] 0.72 sec. 2026-03-19 05:42:48 02184_ipv6_select_parsing: [ OK ] 0.32 sec. 2026-03-19 05:42:48 00155_long_merges: [ SKIPPED ] 0.00 sec. 2026-03-19 05:42:48 Reason: not running for current build 2026-03-19 05:42:48 Running about 406 stateless tests (Process-9). 2026-03-19 05:42:48 02876_yyyymmddtodate: [ OK ] 0.77 sec. 2026-03-19 05:42:48 02482_insert_into_dist_race: [ OK ] 0.32 sec. 2026-03-19 05:42:48 01079_new_range_reader_segfault: [ OK ] 0.33 sec. 2026-03-19 05:42:49 00626_replace_partition_from_table: [ OK ] 0.57 sec. 2026-03-19 05:42:49 01052_array_reduce_exception: [ OK ] 0.27 sec. 2026-03-19 05:42:49 02816_check_projection_metadata: [ OK ] 0.32 sec. 2026-03-19 05:42:49 00589_removal_unused_columns_aggregation: [ OK ] 0.37 sec. 2026-03-19 05:42:49 02002_sampling_and_unknown_column_bug: [ OK ] 0.42 sec. 2026-03-19 05:42:49 02354_vector_search_bugs: [ OK ] 0.52 sec. 2026-03-19 05:42:49 01273_h3EdgeAngle_range_check: [ OK ] 0.27 sec. 2026-03-19 05:42:49 00578_merge_table_and_table_virtual_column: [ OK ] 0.42 sec. 2026-03-19 05:42:49 02236_json_each_row_empty_map_schema_inference: [ OK ] 0.27 sec. 2026-03-19 05:42:49 02903_bug_43644: [ OK ] 0.37 sec. 2026-03-19 05:42:49 02469_interval_msan: [ OK ] 0.42 sec. 2026-03-19 05:42:49 03221_mutate_profile_events: [ OK ] 0.47 sec. 2026-03-19 05:42:49 00862_decimal_in: [ OK ] 0.52 sec. 2026-03-19 05:42:49 01085_simdjson_uint64: [ OK ] 0.32 sec. 2026-03-19 05:42:50 00857_global_joinsavel_table_alias: [ OK ] 0.52 sec. 2026-03-19 05:42:50 02918_parallel_replicas_custom_key_unavailable_replica: [ OK ] 0.42 sec. 2026-03-19 05:42:50 01009_global_array_join_names: [ OK ] 0.32 sec. 2026-03-19 05:42:50 00034_fixed_string_to_number: [ OK ] 0.28 sec. 2026-03-19 05:42:50 02014_map_different_keys: [ OK ] 0.47 sec. 2026-03-19 05:42:51 03002_filter_skip_virtual_columns_with_non_deterministic_functions: [ OK ] 1.57 sec. 2026-03-19 05:42:51 01214_point_in_Mecca: [ OK ] 1.33 sec. 2026-03-19 05:42:51 03210_empty_tuple_lhs_of_in: [ OK ] 0.27 sec. 2026-03-19 05:42:51 00700_to_decimal_or_something: [ OK ] 0.73 sec. 2026-03-19 05:42:51 01034_values_parse_float_bug: [ OK ] 2.27 sec. 2026-03-19 05:42:51 02374_analyzer_join_using: [ OK ] 1.58 sec. 2026-03-19 05:42:51 02524_fuzz_and_fuss: [ OK ] 0.32 sec. 2026-03-19 05:42:51 01544_fromModifiedJulianDay: [ OK ] 0.52 sec. 2026-03-19 05:42:51 02833_sparse_columns_tuple_function: [ OK ] 0.37 sec. 2026-03-19 05:42:51 01499_json_named_tuples: [ OK ] 0.37 sec. 2026-03-19 05:42:51 00619_extract: [ OK ] 0.37 sec. 2026-03-19 05:42:51 00825_protobuf_format_squares: [ OK ] 2.22 sec. 2026-03-19 05:42:52 02582_analyzer_join_subquery_empty_column_list: [ OK ] 0.33 sec. 2026-03-19 05:42:52 02969_archive_seek: [ OK ] 0.77 sec. 2026-03-19 05:42:52 02581_width_bucket: [ OK ] 0.62 sec. 2026-03-19 05:42:52 01056_predicate_optimizer_bugs: [ OK ] 0.72 sec. 2026-03-19 05:42:52 03208_uniq_with_empty_tuple: [ OK ] 0.27 sec. 2026-03-19 05:42:52 02422_insert_different_granularity: [ OK ] 0.57 sec. 2026-03-19 05:42:52 02522_different_types_in_storage_merge: [ OK ] 0.37 sec. 2026-03-19 05:42:52 02006_test_positional_arguments_on_cluster: [ OK ] 0.72 sec. 2026-03-19 05:42:52 01281_sum_nullable: [ OK ] 0.32 sec. 2026-03-19 05:42:53 01559_misplaced_codec_diagnostics: [ OK ] 0.27 sec. 2026-03-19 05:42:53 00232_format_readable_decimal_size: [ OK ] 0.27 sec. 2026-03-19 05:42:53 02502_analyzer_insert_select_crash_fix: [ OK ] 0.32 sec. 2026-03-19 05:42:53 03164_linestring_geometry: [ OK ] 0.37 sec. 2026-03-19 05:42:53 Running about 406 stateless tests (Process-4). 2026-03-19 05:42:53 01666_merge_tree_max_query_limit: [ OK ] 5.54 sec. 2026-03-19 05:42:53 01825_type_json_field: [ OK ] 0.37 sec. 2026-03-19 05:42:53 03033_set_index_in: [ OK ] 0.47 sec. 2026-03-19 05:42:53 00465_nullable_default: [ OK ] 0.32 sec. 2026-03-19 05:42:53 01043_h3_edge_length_m: [ OK ] 0.27 sec. 2026-03-19 05:42:54 01673_test_toMinute_mysql_dialect: [ OK ] 0.27 sec. 2026-03-19 05:42:54 01825_type_json_8: [ OK ] 2.98 sec. 2026-03-19 05:42:54 02783_parsedatetimebesteffort_syslog: [ OK ] 0.32 sec. 2026-03-19 05:42:54 00508_materialized_view_to: [ OK ] 0.32 sec. 2026-03-19 05:42:54 01770_extended_range_3: [ OK ] 0.32 sec. 2026-03-19 05:42:54 00927_asof_join_noninclusive: [ OK ] 0.47 sec. 2026-03-19 05:42:54 01050_engine_join_view_crash: [ OK ] 0.37 sec. 2026-03-19 05:42:55 00520_tuple_values_interpreter: [ OK ] 0.32 sec. 2026-03-19 05:42:55 00625_arrays_in_nested: [ OK ] 0.52 sec. 2026-03-19 05:42:55 03093_reading_bug_with_parallel_replicas: [ OK ] 0.67 sec. 2026-03-19 05:42:55 00131_set_hashed: [ OK ] 0.27 sec. 2026-03-19 05:42:55 00227_quantiles_timing_arbitrary_order: [ OK ] 0.27 sec. 2026-03-19 05:42:55 01058_zlib_ng_level1_bug: [ OK ] 2.23 sec. 2026-03-19 05:42:56 03093_with_fill_support_constant_expression: [ OK ] 0.32 sec. 2026-03-19 05:42:56 00953_constraints_operations: [ OK ] 3.88 sec. 2026-03-19 05:42:56 02896_leading_zeroes_no_octal: [ OK ] 1.27 sec. 2026-03-19 05:42:56 01776_decrypt_aead_size_check: [ OK ] 0.27 sec. 2026-03-19 05:42:56 03230_anyHeavy_merge: [ OK ] 0.32 sec. 2026-03-19 05:42:56 03014_group_by_use_nulls_injective_functions_and_analyzer: [ OK ] 0.27 sec. 2026-03-19 05:42:56 01064_incremental_streaming_from_2_src_with_feedback: [ OK ] 1.27 sec. 2026-03-19 05:42:56 00803_odbc_driver_2_format: [ OK ] 0.27 sec. 2026-03-19 05:42:56 01665_substring_ubsan: [ OK ] 0.37 sec. 2026-03-19 05:42:57 03008_uniq_exact_equal_ranges: [ OK ] 2.38 sec. 2026-03-19 05:42:57 02498_storage_join_key_positions: [ OK ] 0.87 sec. 2026-03-19 05:42:57 00849_multiple_comma_join_2: [ OK ] 0.72 sec. 2026-03-19 05:42:57 01621_clickhouse_compressor: [ OK ] 0.82 sec. 2026-03-19 05:42:57 02674_date_int_string_json_inference: [ OK ] 0.27 sec. 2026-03-19 05:42:58 00296_url_parameters: [ OK ] 0.42 sec. 2026-03-19 05:42:58 02346_fulltext_index_bug52019: [ OK ] 0.42 sec. 2026-03-19 05:42:58 01550_create_map_type: [ OK ] 0.77 sec. 2026-03-19 05:42:58 02416_json_tuple_to_array_schema_inference: [ OK ] 0.32 sec. 2026-03-19 05:42:58 02122_parallel_formatting_TSVWithNames: [ OK ] 1.87 sec. 2026-03-19 05:42:59 01244_optimize_distributed_group_by_sharding_key: [ OK ] 1.07 sec. 2026-03-19 05:42:59 00680_duplicate_columns_inside_union_all: [ OK ] 0.42 sec. 2026-03-19 05:42:59 02543_alter_update_rename_stuck: [ OK ] 5.58 sec. 2026-03-19 05:42:59 02011_normalize_utf8: [ OK ] 0.57 sec. 2026-03-19 05:42:59 00008_array_join: [ OK ] 0.32 sec. 2026-03-19 05:42:59 03198_settings_in_csv_tsv_schema_cache: [ OK ] 1.22 sec. 2026-03-19 05:42:59 00369_int_div_of_float: [ OK ] 0.27 sec. 2026-03-19 05:42:59 00936_function_result_with_operator_in: [ OK ] 0.52 sec. 2026-03-19 05:42:59 01592_toUnixTimestamp_Date: [ OK ] 0.32 sec. 2026-03-19 05:42:59 00975_json_hang: [ OK ] 0.47 sec. 2026-03-19 05:43:00 01433_hex_float: [ OK ] 0.32 sec. 2026-03-19 05:43:00 00586_removing_unused_columns_from_subquery: [ OK ] 0.37 sec. 2026-03-19 05:43:00 01264_nested_baloo_bear: [ OK ] 0.37 sec. 2026-03-19 05:43:00 01631_date_overflow_as_partition_key: [ OK ] 0.37 sec. 2026-03-19 05:43:00 03046_column_in_block_array_join: [ OK ] 0.42 sec. 2026-03-19 05:43:00 02669_alter_modify_to_nullable: [ OK ] 0.67 sec. 2026-03-19 05:43:01 02479_nullable_primary_key_non_first_column: [ OK ] 0.47 sec. 2026-03-19 05:43:01 03167_fancy_quotes_off_by_one: [ OK ] 0.32 sec. 2026-03-19 05:43:01 01763_long_ttl_group_by: [ OK ] 1.67 sec. 2026-03-19 05:43:01 02933_sqid: [ OK ] 2.52 sec. 2026-03-19 05:43:01 00004_shard_format_ast_and_remote_table: [ OK ] 0.32 sec. 2026-03-19 05:43:02 00652_replicated_mutations_zookeeper: [ OK ] 10.45 sec. 2026-03-19 05:43:02 01903_correct_block_size_prediction_with_default: [ OK ] 10.50 sec. 2026-03-19 05:43:02 02481_xxh3_hash_function: [ OK ] 0.27 sec. 2026-03-19 05:43:02 01476_right_full_join_switch: [ OK ] 0.47 sec. 2026-03-19 05:43:02 00753_comment_columns_zookeeper: [ OK ] 0.32 sec. 2026-03-19 05:43:02 01710_normal_projection_join_plan_fix: [ OK ] 0.32 sec. 2026-03-19 05:43:03 02518_delete_on_materialized_view: [ OK ] 0.42 sec. 2026-03-19 05:43:03 00354_host_command_line_option: [ OK ] 1.47 sec. 2026-03-19 05:43:03 02907_backup_restore_flatten_nested: [ OK ] 2.78 sec. 2026-03-19 05:43:03 02031_format_query_option: [ OK ] 0.62 sec. 2026-03-19 05:43:03 01603_decimal_mult_float: [ OK ] 0.32 sec. 2026-03-19 05:43:03 02478_window_frame_type_groups: [ OK ] 0.27 sec. 2026-03-19 05:43:03 01948_group_bitmap_and_or_xor_fix: [ OK ] 0.32 sec. 2026-03-19 05:43:03 00365_statistics_in_formats: [ OK ] 2.42 sec. 2026-03-19 05:43:04 02534_join_prewhere_bug: [ OK ] 0.42 sec. 2026-03-19 05:43:04 02932_punycode: [ OK ] 0.82 sec. 2026-03-19 05:43:04 01402_cast_nullable_string_to_enum: [ OK ] 0.42 sec. 2026-03-19 05:43:04 00717_merge_and_distributed: [ OK ] 0.87 sec. 2026-03-19 05:43:04 03084_analyzer_join_column_alias: [ OK ] 0.37 sec. 2026-03-19 05:43:04 02324_map_combinator_bug: [ OK ] 0.37 sec. 2026-03-19 05:43:04 03140_client_subsequent_external_tables: [ OK ] 0.92 sec. 2026-03-19 05:43:05 02293_ttest_large_samples: [ OK ] 0.97 sec. 2026-03-19 05:43:05 02862_sorted_distinct_sparse_fix: [ OK ] 0.37 sec. 2026-03-19 05:43:05 02375_scalar_lc_cte: [ OK ] 0.32 sec. 2026-03-19 05:43:05 03144_asof_join_ddb_doubles: [ OK ] 0.42 sec. 2026-03-19 05:43:05 02782_values_null_to_lc_nullable: [ OK ] 0.27 sec. 2026-03-19 05:43:05 02354_window_expression_with_aggregation_expression: [ OK ] 0.32 sec. 2026-03-19 05:43:05 02843_context_has_expired: [ OK ] 0.37 sec. 2026-03-19 05:43:05 00600_create_temporary_table_if_not_exists: [ OK ] 0.37 sec. 2026-03-19 05:43:06 00520_http_nullable: [ OK ] 0.72 sec. 2026-03-19 05:43:06 02895_npy_format: [ OK ] 8.39 sec. 2026-03-19 05:43:06 01515_logtrace_function: [ OK ] 0.87 sec. 2026-03-19 05:43:06 01818_case_float_value_fangyc: [ OK ] 0.27 sec. 2026-03-19 05:43:06 02918_implicit_sign_column_constraints_for_collapsing_engine: [ OK ] 4.08 sec. 2026-03-19 05:43:06 00224_shard_distributed_aggregation_memory_efficient_and_overflows: [ OK ] 0.47 sec. 2026-03-19 05:43:06 02807_lower_utf8_msan: [ OK ] 0.37 sec. 2026-03-19 05:43:06 03023_zeros_generate_random_with_limit_progress_bar: [ OK ] 0.72 sec. 2026-03-19 05:43:07 02382_analyzer_matcher_join_using: [ OK ] 0.52 sec. 2026-03-19 05:43:07 00688_low_cardinality_in: [ OK ] 0.42 sec. 2026-03-19 05:43:07 01389_filter_by_virtual_columns: [ OK ] 0.27 sec. 2026-03-19 05:43:07 01746_test_for_tupleElement_must_be_constant_issue: [ OK ] 0.42 sec. 2026-03-19 05:43:07 02503_in_lc_const_args_bug: [ OK ] 0.32 sec. 2026-03-19 05:43:07 01560_optimize_on_insert_zookeeper: [ OK ] 0.47 sec. 2026-03-19 05:43:07 00726_length_aliases: [ OK ] 0.32 sec. 2026-03-19 05:43:07 02887_format_readable_timedelta_subseconds: [ OK ] 0.37 sec. 2026-03-19 05:43:08 02426_to_string_nullable_fixedstring: [ OK ] 0.37 sec. 2026-03-19 05:43:08 02366_kql_operator_in_sql: [ OK ] 0.42 sec. 2026-03-19 05:43:08 02798_generic_transform: [ OK ] 0.37 sec. 2026-03-19 05:43:08 02874_parse_json_as_json_each_row_on_no_metadata: [ OK ] 0.32 sec. 2026-03-19 05:43:09 02786_parquet_big_integer_compatibility: [ OK ] 0.87 sec. 2026-03-19 05:43:09 03031_filter_float64_logical_error: [ OK ] 0.32 sec. 2026-03-19 05:43:09 02384_analyzer_dict_get_join_get: [ OK ] 0.42 sec. 2026-03-19 05:43:09 02877_optimize_read_in_order_from_view: [ OK ] 2.57 sec. 2026-03-19 05:43:09 01538_fuzz_aggregate: [ OK ] 0.27 sec. 2026-03-19 05:43:10 01602_modified_julian_day_msan: [ OK ] 0.37 sec. 2026-03-19 05:43:10 01010_pm_join_all_join_bug: [ OK ] 0.37 sec. 2026-03-19 05:43:10 02751_multiif_to_if_crash: [ OK ] 0.32 sec. 2026-03-19 05:43:10 00223_shard_distributed_aggregation_memory_efficient: [ OK ] 2.72 sec. 2026-03-19 05:43:10 01084_defaults_on_aliases: [ OK ] 0.32 sec. 2026-03-19 05:43:10 02869_unicode_minus: [ OK ] 0.27 sec. 2026-03-19 05:43:10 02293_http_header_full_summary_without_progress: [ OK ] 1.67 sec. 2026-03-19 05:43:10 02234_position_case_insensitive_utf8: [ OK ] 0.27 sec. 2026-03-19 05:43:10 02499_analyzer_set_index: [ OK ] 0.32 sec. 2026-03-19 05:43:11 00284_external_aggregation_2: [ OK ] 5.53 sec. 2026-03-19 05:43:11 02494_zero_copy_and_projection_and_mutation_work_together: [ OK ] 5.58 sec. 2026-03-19 05:43:11 01670_log_comment: [ OK ] 0.57 sec. 2026-03-19 05:43:11 01355_alter_column_with_order: [ OK ] 0.47 sec. 2026-03-19 05:43:11 02560_window_ntile: [ OK ] 0.47 sec. 2026-03-19 05:43:11 01942_untuple_transformers_msan: [ OK ] 0.27 sec. 2026-03-19 05:43:11 01604_explain_ast_of_nonselect_query: [ OK ] 0.27 sec. 2026-03-19 05:43:11 02815_join_algorithm_setting: [ OK ] 0.87 sec. 2026-03-19 05:43:11 01284_port: [ OK ] 0.57 sec. 2026-03-19 05:43:12 02990_format_not_precedence: [ OK ] 0.32 sec. 2026-03-19 05:43:12 02515_aggregate_functions_statistics: [ OK ] 0.42 sec. 2026-03-19 05:43:12 01339_client_unrecognized_option: [ OK ] 0.87 sec. 2026-03-19 05:43:12 00322_disable_checksumming: [ OK ] 0.62 sec. 2026-03-19 05:43:12 01011_test_create_as_skip_indices: [ OK ] 0.32 sec. 2026-03-19 05:43:12 00077_set_keys_fit_128_bits_many_blocks: [ OK ] 0.32 sec. 2026-03-19 05:43:13 03143_cte_scope: [ OK ] 0.42 sec. 2026-03-19 05:43:13 01448_json_compact_strings_each_row: [ OK ] 0.62 sec. 2026-03-19 05:43:13 02486_truncate_and_unexpected_parts: [ OK ] 1.32 sec. 2026-03-19 05:43:14 01560_crash_in_agg_empty_arglist: [ OK ] 0.67 sec. 2026-03-19 05:43:14 02554_invalid_create_view_syntax: [ OK ] 0.42 sec. 2026-03-19 05:43:14 01338_long_select_and_alter_zookeeper: [ OK ] 14.01 sec. 2026-03-19 05:43:15 03198_unload_primary_key_outdated: [ OK ] 2.73 sec. 2026-03-19 05:43:15 00122_join_with_subquery_with_subquery: [ OK ] 0.27 sec. 2026-03-19 05:43:15 02024_compile_expressions_with_short_circuit_evaluation: [ OK ] 0.32 sec. 2026-03-19 05:43:15 01921_datatype_date32: [ OK ] 0.82 sec. 2026-03-19 05:43:15 03210_dynamic_squashing: [ OK ] 0.57 sec. 2026-03-19 05:43:15 02891_rename_table_without_keyword: [ OK ] 0.37 sec. 2026-03-19 05:43:15 01732_union_and_union_all: [ OK ] 0.27 sec. 2026-03-19 05:43:16 00950_bad_alloc_when_truncate_join_storage: [ OK ] 0.27 sec. 2026-03-19 05:43:16 00098_f_union_all: [ OK ] 0.32 sec. 2026-03-19 05:43:16 02026_accurate_cast_or_default: [ OK ] 0.62 sec. 2026-03-19 05:43:16 01497_extract_all_groups_empty_match: [ OK ] 0.32 sec. 2026-03-19 05:43:16 00240_replace_substring_loop: [ OK ] 0.82 sec. 2026-03-19 05:43:17 01032_cityHash64_for_UUID: [ OK ] 0.42 sec. 2026-03-19 05:43:17 00147_alter_nested_default: [ OK ] 0.52 sec. 2026-03-19 05:43:17 01280_null_in: [ OK ] 0.32 sec. 2026-03-19 05:43:17 00260_like_and_curly_braces: [ OK ] 0.42 sec. 2026-03-19 05:43:17 01386_negative_float_constant_key_condition: [ OK ] 0.32 sec. 2026-03-19 05:43:17 02752_space_function: [ OK ] 0.52 sec. 2026-03-19 05:43:17 02015_async_inserts_4: [ OK ] 4.93 sec. 2026-03-19 05:43:17 03131_rewrite_sum_if_nullable: [ OK ] 0.32 sec. 2026-03-19 05:43:17 02515_analyzer_null_for_empty: [ OK ] 0.27 sec. 2026-03-19 05:43:18 01770_add_months_ubsan: [ OK ] 0.27 sec. 2026-03-19 05:43:18 02871_multiple_joins_rewriter_v2_handle_last_table_columns: [ OK ] 0.32 sec. 2026-03-19 05:43:18 01460_allow_dollar_and_number_in_identifier: [ OK ] 0.27 sec. 2026-03-19 05:43:18 00967_insert_into_distributed_different_types: [ OK ] 0.42 sec. 2026-03-19 05:43:18 02223_h3_test_const_columns: [ OK ] 0.42 sec. 2026-03-19 05:43:18 01683_intdiv_ubsan: [ OK ] 0.42 sec. 2026-03-19 05:43:19 01838_system_dictionaries_virtual_key_column: [ OK ] 0.32 sec. 2026-03-19 05:43:19 02982_create_mv_inner_extra: [ OK ] 0.27 sec. 2026-03-19 05:43:19 01446_json_strings_each_row: [ OK ] 8.24 sec. 2026-03-19 05:43:19 02980_s3_plain_DROP_TABLE_ReplicatedMergeTree: [ OK ] 1.67 sec. 2026-03-19 05:43:19 00842_array_with_constant_overflow: [ OK ] 0.27 sec. 2026-03-19 05:43:19 00848_join_use_nulls_segfault: [ OK ] 0.62 sec. 2026-03-19 05:43:19 02315_readonly_create_function: [ OK ] 0.87 sec. 2026-03-19 05:43:20 02371_create_temporary_table_as_with_columns_list: [ OK ] 0.42 sec. 2026-03-19 05:43:21 02987_group_array_intersect: [ OK ] 1.32 sec. 2026-03-19 05:43:21 00800_versatile_storage_join: [ OK ] 0.57 sec. 2026-03-19 05:43:22 01276_random_string: [ OK ] 1.62 sec. 2026-03-19 05:43:22 02971_functions_to_subcolumns_map: [ OK ] 0.37 sec. 2026-03-19 05:43:22 02695_logical_optimizer_alias_bug: [ OK ] 0.42 sec. 2026-03-19 05:43:22 03165_string_functions_with_token_text_indexes: [ OK ] 0.72 sec. 2026-03-19 05:43:22 00662_array_has_nullable: [ OK ] 0.47 sec. 2026-03-19 05:43:23 02160_special_functions: [ OK ] 0.47 sec. 2026-03-19 05:43:23 02497_if_transform_strings_to_enum: [ OK ] 0.62 sec. 2026-03-19 05:43:23 02220_array_join_format: [ OK ] 0.27 sec. 2026-03-19 05:43:24 00633_materialized_view_and_too_many_parts_zookeeper: [ OK ] 6.99 sec. 2026-03-19 05:43:24 02482_value_block_parsing: [ OK ] 0.97 sec. 2026-03-19 05:43:25 02150_replace_regexp_all_empty_match: [ OK ] 0.32 sec. 2026-03-19 05:43:25 02586_generate_random_structure: [ OK ] 0.57 sec. 2026-03-19 05:43:25 01550_query_identifier_parameters: [ OK ] 2.28 sec. 2026-03-19 05:43:26 01556_explain_select_with_union_query: [ OK ] 0.37 sec. 2026-03-19 05:43:26 01654_test_writer_block_sequence: [ OK ] 12.90 sec. 2026-03-19 05:43:26 02192_comment_error: [ OK ] 1.62 sec. 2026-03-19 05:43:27 01655_test_isnull_mysql_dialect: [ OK ] 0.32 sec. 2026-03-19 05:43:27 01509_format_raw_blob: [ OK ] 1.77 sec. 2026-03-19 05:43:27 01866_bit_positions_to_array: [ OK ] 0.57 sec. 2026-03-19 05:43:27 02312_parquet_orc_arrow_names_tuples: [ OK ] 0.42 sec. 2026-03-19 05:43:27 02366_normalize_aggregate_function_types_and_states: [ OK ] 0.42 sec. 2026-03-19 05:43:27 02595_orc_arrow_parquet_more_types: [ OK ] 1.47 sec. 2026-03-19 05:43:27 01073_show_tables_not_like: [ OK ] 0.37 sec. 2026-03-19 05:43:28 01710_projection_optimize_group_by_function_keys: [ OK ] 0.37 sec. 2026-03-19 05:43:28 02901_analyzer_recursive_window: [ OK ] 0.42 sec. 2026-03-19 05:43:28 02470_suspicious_low_cardinality_msan: [ OK ] 0.37 sec. 2026-03-19 05:43:28 02174_cte_scalar_cache_mv: [ OK ] 1.68 sec. 2026-03-19 05:43:29 02360_send_logs_level_colors: [ OK ] 1.57 sec. 2026-03-19 05:43:29 01603_remove_column_ttl: [ OK ] 0.37 sec. 2026-03-19 05:43:29 00627_recursive_alias: [ OK ] 0.37 sec. 2026-03-19 05:43:30 02316_const_string_intersact: [ OK ] 0.32 sec. 2026-03-19 05:43:30 03015_aggregator_empty_data_multiple_blocks: [ OK ] 0.32 sec. 2026-03-19 05:43:30 00148_summing_merge_tree_aggregate_function: [ OK ] 1.87 sec. 2026-03-19 05:43:31 02033_join_engine_deadlock_long: [ OK ] 2.43 sec. 2026-03-19 05:43:31 00732_quorum_insert_lost_part_and_alive_part_zookeeper_long: [ OK ] 0.52 sec. 2026-03-19 05:43:31 02800_transform_alter: [ OK ] 0.42 sec. 2026-03-19 05:43:32 02875_show_functions: [ OK ] 1.57 sec. 2026-03-19 05:43:32 03039_dynamic_summing_merge_tree: [ OK ] 13.25 sec. 2026-03-19 05:43:33 01475_read_subcolumns_2: [ OK ] 0.47 sec. 2026-03-19 05:43:33 02912_group_array_sample: [ OK ] 0.32 sec. 2026-03-19 05:43:33 02896_max_execution_time_with_break_overflow_mode: [ OK ] 5.29 sec. 2026-03-19 05:43:33 01085_extract_all_empty: [ OK ] 0.27 sec. 2026-03-19 05:43:33 01655_sleep_infinite_float: [ OK ] 0.32 sec. 2026-03-19 05:43:33 01514_parallel_formatting: [ OK ] 2.22 sec. 2026-03-19 05:43:33 00938_test_retention_function: [ OK ] 0.47 sec. 2026-03-19 05:43:34 01502_bar_overflow: [ OK ] 0.47 sec. 2026-03-19 05:43:34 02678_explain_pipeline_graph_with_projection: [ OK ] 0.47 sec. 2026-03-19 05:43:34 00810_in_operators_segfault: [ OK ] 0.32 sec. 2026-03-19 05:43:34 01021_only_tuple_columns: [ OK ] 0.52 sec. 2026-03-19 05:43:34 02834_formats_with_variable_number_of_columns: [ OK ] 0.32 sec. 2026-03-19 05:43:34 00980_full_join_crash_fancyqlx: [ OK ] 0.42 sec. 2026-03-19 05:43:34 01319_query_formatting_in_server_log: [ OK ] 0.52 sec. 2026-03-19 05:43:35 01072_select_constant_limit: [ OK ] 0.27 sec. 2026-03-19 05:43:35 00999_settings_no_extra_quotes: [ OK ] 0.37 sec. 2026-03-19 05:43:35 03009_format_show_database: [ OK ] 1.12 sec. 2026-03-19 05:43:35 03038_ambiguous_column: [ OK ] 0.32 sec. 2026-03-19 05:43:35 02100_multiple_hosts_command_line_set_ssl: [ OK ] 31.80 sec. 2026-03-19 05:43:35 00652_replicated_mutations_default_database_zookeeper: [ OK ] 1.97 sec. 2026-03-19 05:43:35 03208_array_of_json_read_subcolumns_2_compact_merge_tree: [ SKIPPED ] 0.00 sec. 2026-03-19 05:43:35 Reason: not running for current build 2026-03-19 05:43:36 03168_fuzz_multiIf_short_circuit: [ OK ] 0.32 sec. 2026-03-19 05:43:36 02381_arrow_dict_to_lc: [ OK ] 0.82 sec. 2026-03-19 05:43:36 00447_foreach_modifier: [ OK ] 0.48 sec. 2026-03-19 05:43:36 02030_function_mapContainsKeyLike: [ OK ] 0.37 sec. 2026-03-19 05:43:37 00829_bitmap64_function: [ OK ] 0.52 sec. 2026-03-19 05:43:38 02725_cnf_large_check: [ OK ] 0.72 sec. 2026-03-19 05:43:38 02428_parameterized_view: [ OK ] 27.85 sec. 2026-03-19 05:43:38 02766_prql: [ OK ] 2.48 sec. 2026-03-19 05:43:38 02414_all_new_table_functions_must_be_documented: [ OK ] 0.32 sec. 2026-03-19 05:43:39 02998_projection_after_attach_partition: [ OK ] 0.42 sec. 2026-03-19 05:43:39 00738_lock_for_inner_table: [ OK ] 3.08 sec. 2026-03-19 05:43:40 02004_intersect_except_distinct_operators: [ OK ] 0.77 sec. 2026-03-19 05:43:40 02725_any_join_single_row: [ OK ] 0.52 sec. 2026-03-19 05:43:40 02421_json_decimals_as_strings: [ OK ] 0.27 sec. 2026-03-19 05:43:40 02941_variant_type_2: [ OK ] 9.72 sec. 2026-03-19 05:43:40 02874_json_merge_patch_function_test: [ OK ] 0.47 sec. 2026-03-19 05:43:40 01273_arrow_arrays_load: [ OK ] 2.73 sec. 2026-03-19 05:43:40 00974_low_cardinality_cast: [ OK ] 0.47 sec. 2026-03-19 05:43:41 00568_empty_function_with_fixed_string: [ OK ] 0.47 sec. 2026-03-19 05:43:41 03215_varian_as_common_type_tuple_map: [ OK ] 0.37 sec. 2026-03-19 05:43:41 03212_max_bytes_to_read_for_schema_inference_in_cache: [ OK ] 0.87 sec. 2026-03-19 05:43:41 02918_analyzer_to_ast_crash: [ OK ] 0.38 sec. 2026-03-19 05:43:41 02715_or_null: [ OK ] 0.32 sec. 2026-03-19 05:43:41 02387_parse_date_as_datetime: [ OK ] 0.37 sec. 2026-03-19 05:43:41 00030_alter_table: [ OK ] 0.57 sec. 2026-03-19 05:43:41 02025_storage_filelog_virtual_col: [ OK ] 5.84 sec. 2026-03-19 05:43:42 02811_insert_schema_inference: [ OK ] 0.33 sec. 2026-03-19 05:43:42 01852_hints_enum_name: [ OK ] 0.92 sec. 2026-03-19 05:43:42 02155_nested_lc_defalut_bug: [ OK ] 0.37 sec. 2026-03-19 05:43:42 03161_ipv4_ipv6_equality: [ OK ] 0.37 sec. 2026-03-19 05:43:42 00681_duplicate_columns_inside_union_all_stas_sviridov: [ OK ] 0.38 sec. 2026-03-19 05:43:42 02967_index_hint_crash: [ OK ] 0.42 sec. 2026-03-19 05:43:42 02416_rocksdb_delete_update: [ OK ] 0.48 sec. 2026-03-19 05:43:42 03008_filter_projections_non_deterministoc_functions: [ OK ] 0.62 sec. 2026-03-19 05:43:43 02398_subquery_where_pushdown_and_limit_offset: [ OK ] 0.38 sec. 2026-03-19 05:43:43 02421_truncate_isolation_no_merges: [ OK ] 23.79 sec. 2026-03-19 05:43:43 02030_client_unknown_database: [ OK ] 1.02 sec. 2026-03-19 05:43:43 01675_distributed_bytes_to_delay_insert: [ OK ] 5.24 sec. 2026-03-19 05:43:43 01381_for_each_with_states: [ OK ] 0.37 sec. 2026-03-19 05:43:43 00594_alias_in_distributed: [ OK ] 0.87 sec. 2026-03-19 05:43:43 01667_aes_args_check: [ OK ] 0.27 sec. 2026-03-19 05:43:44 02933_compare_with_bool_as_string: [ OK ] 0.37 sec. 2026-03-19 05:43:44 01088_array_slice_of_aggregate_functions: [ OK ] 0.32 sec. 2026-03-19 05:43:44 02842_mutations_replace_non_deterministic: [ OK ] 1.37 sec. 2026-03-19 05:43:44 00847_multiple_join_same_column: [ OK ] 0.47 sec. 2026-03-19 05:43:44 02022_storage_filelog_one_file: [ OK ] 3.63 sec. 2026-03-19 05:43:44 01013_hex_decimal: [ OK ] 0.47 sec. 2026-03-19 05:43:45 00973_uniq_non_associativity: [ OK ] 1.22 sec. 2026-03-19 05:43:45 02535_analyzer_limit_offset: [ OK ] 0.37 sec. 2026-03-19 05:43:45 03032_storage_memory_modify_settings: [ OK ] 0.72 sec. 2026-03-19 05:43:45 02687_native_fuzz: [ OK ] 0.37 sec. 2026-03-19 05:43:45 01825_type_json_in_array: [ OK ] 0.52 sec. 2026-03-19 05:43:45 00725_join_on_bug_2: [ OK ] 0.57 sec. 2026-03-19 05:43:45 00999_test_skip_indices_with_alter_and_merge: [ OK ] 0.57 sec. 2026-03-19 05:43:46 01165_lost_part_empty_partition: [ OK ] 3.59 sec. 2026-03-19 05:43:46 01012_serialize_array_memory_usage: [ OK ] 0.67 sec. 2026-03-19 05:43:46 00310_tskv: [ OK ] 2.38 sec. 2026-03-19 05:43:46 02133_issue_32458: [ OK ] 0.47 sec. 2026-03-19 05:43:46 00515_enhanced_time_zones: [ OK ] 0.97 sec. 2026-03-19 05:43:47 02025_having_filter_column: [ OK ] 0.57 sec. 2026-03-19 05:43:47 02381_client_prints_server_side_time: [ SKIPPED ] 0.00 sec. 2026-03-19 05:43:47 Reason: not running for current build 2026-03-19 05:43:47 00362_great_circle_distance: [ OK ] 0.58 sec. 2026-03-19 05:43:47 03121_analyzer_filed_redefenition_in_subquery: [ OK ] 0.43 sec. 2026-03-19 05:43:47 02813_seriesOutliersDetectTukey: [ OK ] 0.73 sec. 2026-03-19 05:43:47 01009_insert_select_data_loss: [ OK ] 0.47 sec. 2026-03-19 05:43:48 00471_sql_style_quoting: [ OK ] 0.53 sec. 2026-03-19 05:43:48 03063_analyzer_multi_join_wrong_table_specifier: [ OK ] 0.64 sec. 2026-03-19 05:43:48 02883_read_in_reverse_order_virtual_column: [ OK ] 1.19 sec. 2026-03-19 05:43:48 02155_parse_date_lowcard_default_throw: [ OK ] 0.53 sec. 2026-03-19 05:43:48 01914_index_bgranvea: [ OK ] 0.42 sec. 2026-03-19 05:43:48 00098_l_union_all: [ OK ] 0.49 sec. 2026-03-19 05:43:49 03271_decimal_monotonic_day_of_week: [ OK ] 0.68 sec. 2026-03-19 05:43:49 03037_dynamic_merges_2_horizontal_wide_merge_tree: [ OK ] 0.93 sec. 2026-03-19 05:43:49 01069_insert_float_as_nullable_unit8: [ OK ] 0.49 sec. 2026-03-19 05:43:50 02731_replace_partition_from_temporary_table: [ OK ] 2.16 sec. 2026-03-19 05:43:51 02235_add_part_offset_virtual_column: [ OK ] 1.59 sec. 2026-03-19 05:43:51 01509_parallel_quorum_and_merge_long: [ OK ] 8.17 sec. 2026-03-19 05:43:51 02518_parquet_arrow_orc_boolean_value: [ OK ] 1.89 sec. 2026-03-19 05:43:52 01483_merge_table_join_and_group_by: [ OK ] 0.58 sec. 2026-03-19 05:43:52 02915_input_table_function_in_subquery: [ OK ] 1.54 sec. 2026-03-19 05:43:52 02956_clickhouse_local_system_parts: [ OK ] 1.20 sec. 2026-03-19 05:43:52 02481_default_value_used_in_row_level_filter: [ OK ] 0.42 sec. 2026-03-19 05:43:53 01187_set_profile_as_setting: [ OK ] 1.28 sec. 2026-03-19 05:43:53 02207_ttl_move_if_exists: [ OK ] 0.33 sec. 2026-03-19 05:43:53 02787_transform_null: [ OK ] 0.37 sec. 2026-03-19 05:43:53 00623_replicated_truncate_table_zookeeper_long: [ OK ] 0.62 sec. 2026-03-19 05:43:54 02597_column_delete_and_replication: [ OK ] 1.49 sec. 2026-03-19 05:43:54 01082_bit_test_out_of_bound: [ OK ] 0.47 sec. 2026-03-19 05:43:54 02369_analyzer_array_join_function: [ OK ] 0.49 sec. 2026-03-19 05:43:54 02122_4letter_words_stress_zookeeper: [ OK ] 19.19 sec. 2026-03-19 05:43:54 01716_drop_rename_sign_column: [ OK ] 0.42 sec. 2026-03-19 05:43:54 03217_filtering_in_storage_merge: [ OK ] 0.42 sec. 2026-03-19 05:43:54 02902_select_subcolumns_from_engine_null: [ OK ] 0.32 sec. 2026-03-19 05:43:54 01710_projection_group_by_order_by: [ OK ] 0.27 sec. 2026-03-19 05:43:55 02245_s3_virtual_columns: [ OK ] 0.53 sec. 2026-03-19 05:43:56 02293_http_header_summary_contains_exception_code_with_progress: [ OK ] 2.08 sec. 2026-03-19 05:43:56 01471_top_k_range_check: [ OK ] 0.33 sec. 2026-03-19 05:43:56 02124_buffer_with_type_map_long: [ OK ] 11.54 sec. 2026-03-19 05:43:56 02340_union_header: [ OK ] 0.37 sec. 2026-03-19 05:43:57 01825_type_json_mutations: [ OK ] 0.42 sec. 2026-03-19 05:43:57 02251_alter_enum_nested_struct: [ OK ] 0.57 sec. 2026-03-19 05:43:57 00632_get_sample_block_cache: [ OK ] 2.69 sec. 2026-03-19 05:43:58 01089_alter_settings_old_format: [ OK ] 0.32 sec. 2026-03-19 05:43:58 01739_index_hint: [ OK ] 0.62 sec. 2026-03-19 05:43:58 00900_orc_arrow_parquet_tuples: [ OK ] 5.70 sec. 2026-03-19 05:43:58 01511_different_expression_with_same_alias: [ OK ] 0.27 sec. 2026-03-19 05:43:58 02205_map_populate_series_non_const: [ OK ] 0.62 sec. 2026-03-19 05:43:59 01648_mutations_and_escaping: [ OK ] 4.89 sec. 2026-03-19 05:43:59 02568_json_array_length: [ OK ] 0.37 sec. 2026-03-19 05:44:00 00976_max_execution_speed: [ OK ] 3.28 sec. 2026-03-19 05:44:00 01374_if_nullable_filimonov: [ OK ] 0.32 sec. 2026-03-19 05:44:00 01283_strict_resize_bug: [ OK ] 1.32 sec. 2026-03-19 05:44:00 01113_local_dictionary_type_conversion: [ OK ] 0.37 sec. 2026-03-19 05:44:00 02532_send_logs_level_test: [ SKIPPED ] 0.00 sec. 2026-03-19 05:44:00 Reason: not running for current build 2026-03-19 05:44:00 02191_parse_date_time_best_effort_more_cases: [ OK ] 0.42 sec. 2026-03-19 05:44:01 00752_low_cardinality_lambda_argument: [ OK ] 0.37 sec. 2026-03-19 05:44:01 01750_parsing_exception: [ OK ] 0.92 sec. 2026-03-19 05:44:01 00416_pocopatch_progress_in_http_headers: [ OK ] 0.77 sec. 2026-03-19 05:44:01 02049_lowcardinality_shortcircuit_crash: [ OK ] 0.32 sec. 2026-03-19 05:44:01 00569_parse_date_time_best_effort: [ OK ] 0.32 sec. 2026-03-19 05:44:01 02125_dict_get_type_nullable_fix: [ OK ] 0.32 sec. 2026-03-19 05:44:01 02184_ipv6_cast_test: [ OK ] 0.32 sec. 2026-03-19 05:44:02 00945_bloom_filter_index: [ OK ] 3.48 sec. 2026-03-19 05:44:02 02910_object-json-crash-add-column: [ OK ] 0.47 sec. 2026-03-19 05:44:02 03035_dynamic_sorting: [ OK ] 0.42 sec. 2026-03-19 05:44:02 02361_fsync_profile_events: [ OK ] 1.57 sec. 2026-03-19 05:44:02 02006_use_constants_in_with_and_select: [ OK ] 0.32 sec. 2026-03-19 05:44:02 01852_s2_get_neighbours: [ OK ] 0.32 sec. 2026-03-19 05:44:02 03205_system_sync_replica_format: [ OK ] 0.27 sec. 2026-03-19 05:44:03 02982_dont_infer_exponent_floats: [ OK ] 0.37 sec. 2026-03-19 05:44:03 00725_join_on_bug_4: [ OK ] 0.32 sec. 2026-03-19 05:44:03 01039_row_policy_dcl: [ OK ] 0.82 sec. 2026-03-19 05:44:03 02148_cast_type_parsing: [ OK ] 0.27 sec. 2026-03-19 05:44:03 01070_h3_to_parent: [ OK ] 0.27 sec. 2026-03-19 05:44:03 02375_pretty_formats: [ OK ] 0.47 sec. 2026-03-19 05:44:03 01663_quantile_weighted_overflow: [ OK ] 0.37 sec. 2026-03-19 05:44:03 02675_grant_query_formatting: [ OK ] 0.57 sec. 2026-03-19 05:44:04 01442_h3kring_range_check: [ OK ] 0.52 sec. 2026-03-19 05:44:04 01661_test_toDayOfWeek_mysql_compatibility: [ OK ] 0.37 sec. 2026-03-19 05:44:04 02366_kql_func_math: [ OK ] 0.32 sec. 2026-03-19 05:44:04 02895_peak_memory_usage_http_headers_regression: [ OK ] 0.82 sec. 2026-03-19 05:44:04 02581_share_big_sets_between_mutation_tasks: [ OK ] 10.16 sec. 2026-03-19 05:44:04 01846_alter_column_without_type_bugfix: [ OK ] 0.32 sec. 2026-03-19 05:44:05 01866_view_persist_settings: [ OK ] 0.67 sec. 2026-03-19 05:44:05 01630_simple_aggregate_function_in_summing_merge_tree: [ OK ] 0.37 sec. 2026-03-19 05:44:05 02711_server_uuid_macro: [ OK ] 0.37 sec. 2026-03-19 05:44:05 01780_column_sparse_pk: [ OK ] 0.47 sec. 2026-03-19 05:44:05 01825_type_json_1: [ OK ] 0.52 sec. 2026-03-19 05:44:05 02021_create_database_with_comment: [ OK ] 3.13 sec. 2026-03-19 05:44:06 02454_create_table_with_custom_disk: [ OK ] 0.37 sec. 2026-03-19 05:44:06 02017_bit_shift_left_for_string_integer: [ OK ] 0.77 sec. 2026-03-19 05:44:06 02433_default_expression_operator_in: [ OK ] 0.37 sec. 2026-03-19 05:44:06 03262_column_sizes_with_dynamic_structure: [ OK ] 1.52 sec. 2026-03-19 05:44:06 03146_bug47862: [ OK ] 0.32 sec. 2026-03-19 05:44:06 03167_empty_tuple_concat: [ OK ] 0.27 sec. 2026-03-19 05:44:06 00997_extract_all_crash_6627: [ OK ] 0.37 sec. 2026-03-19 05:44:06 02003_WithMergeableStateAfterAggregationAndLimit_LIMIT_BY_LIMIT_OFFSET: [ OK ] 0.37 sec. 2026-03-19 05:44:06 01773_min_max_time_system_parts_datetime64: [ OK ] 0.32 sec. 2026-03-19 05:44:07 01935_parametrized_query_parametric_aggregate_function: [ OK ] 0.62 sec. 2026-03-19 05:44:07 02352_interactive_queries_from_file: [ OK ] 0.87 sec. 2026-03-19 05:44:07 02302_clash_const_aggegate_join: [ OK ] 0.62 sec. 2026-03-19 05:44:07 03201_avro_negative_block_size_arrays: [ OK ] 0.92 sec. 2026-03-19 05:44:07 03077_analyzer_multi_scalar_subquery_aliases: [ OK ] 0.42 sec. 2026-03-19 05:44:07 02861_join_on_nullsafe_compare: [ OK ] 1.02 sec. 2026-03-19 05:44:08 03210_nested_short_circuit_functions_bug: [ OK ] 0.27 sec. 2026-03-19 05:44:08 02098_date32_comparison: [ OK ] 0.47 sec. 2026-03-19 05:44:08 02886_missed_json_subcolumns: [ OK ] 0.47 sec. 2026-03-19 05:44:08 03169_cache_complex_dict_short_circuit_bug: [ OK ] 0.42 sec. 2026-03-19 05:44:08 01343_min_bytes_to_use_mmap_io: [ OK ] 0.67 sec. 2026-03-19 05:44:08 00351_select_distinct_arrays_tuples: [ OK ] 0.47 sec. 2026-03-19 05:44:08 00618_nullable_in: [ OK ] 0.32 sec. 2026-03-19 05:44:08 00205_scalar_subqueries: [ OK ] 0.52 sec. 2026-03-19 05:44:09 01055_compact_parts_1: [ OK ] 0.37 sec. 2026-03-19 05:44:09 00563_shard_insert_into_remote: [ OK ] 0.37 sec. 2026-03-19 05:44:09 01293_pretty_max_value_width: [ OK ] 0.42 sec. 2026-03-19 05:44:09 02242_optimize_to_subcolumns_no_storage: [ OK ] 0.32 sec. 2026-03-19 05:44:09 03151_dynamic_type_scale_max_types: [ OK ] 0.47 sec. 2026-03-19 05:44:09 02456_aggregate_state_conversion: [ OK ] 0.27 sec. 2026-03-19 05:44:09 00616_final_single_part: [ OK ] 0.47 sec. 2026-03-19 05:44:09 01623_byte_size_const: [ OK ] 0.37 sec. 2026-03-19 05:44:09 00462_json_true_false_literals: [ OK ] 0.37 sec. 2026-03-19 05:44:09 01428_h3_range_check: [ OK ] 0.32 sec. 2026-03-19 05:44:10 00273_quantiles: [ OK ] 0.57 sec. 2026-03-19 05:44:10 03204_distributed_with_scalar_subquery: [ OK ] 0.32 sec. 2026-03-19 05:44:10 01786_group_by_pk_many_streams: [ OK ] 0.57 sec. 2026-03-19 05:44:10 02019_multiple_weird_with_fill: [ OK ] 0.32 sec. 2026-03-19 05:44:10 01550_mutation_subquery: [ OK ] 0.32 sec. 2026-03-19 05:44:10 00003_reinterpret_as_string: [ OK ] 0.37 sec. 2026-03-19 05:44:10 03033_lightweight_deletes_sync: [ OK ] 0.37 sec. 2026-03-19 05:44:10 01531_query_log_query_comment: [ OK ] 0.57 sec. 2026-03-19 05:44:10 01521_alter_enum_and_reverse_read: [ OK ] 0.32 sec. 2026-03-19 05:44:11 02969_analyzer_eliminate_injective_functions: [ OK ] 0.32 sec. 2026-03-19 05:44:11 01915_json_extract_raw_string: [ OK ] 0.32 sec. 2026-03-19 05:44:11 00957_neighbor: [ OK ] 0.47 sec. 2026-03-19 05:44:13 00612_pk_in_tuple_perf: [ OK ] 2.82 sec. 2026-03-19 05:44:13 00100_subquery_table_identifier: [ OK ] 2.18 sec. 2026-03-19 05:44:14 03208_buffer_over_distributed_type_mismatch: [ OK ] 0.67 sec. 2026-03-19 05:44:14 01586_columns_pruning: [ OK ] 0.42 sec. 2026-03-19 05:44:14 02241_parquet_bad_column: [ OK ] 3.28 sec. 2026-03-19 05:44:14 02353_ascii: [ OK ] 0.32 sec. 2026-03-19 05:44:14 03001_block_offset_column: [ OK ] 0.52 sec. 2026-03-19 05:44:15 01755_shard_pruning_with_literal: [ OK ] 0.37 sec. 2026-03-19 05:44:15 00804_rollup_with_having: [ OK ] 0.32 sec. 2026-03-19 05:44:15 01528_to_uuid_or_null_or_zero: [ OK ] 0.47 sec. 2026-03-19 05:44:15 00956_join_use_nulls_with_array_column: [ OK ] 0.27 sec. 2026-03-19 05:44:15 02882_formatQuery: [ OK ] 0.47 sec. 2026-03-19 05:44:15 02790_client_max_opening_fd: [ OK ] 0.82 sec. 2026-03-19 05:44:15 02974_analyzer_array_join_subcolumn: [ OK ] 0.37 sec. 2026-03-19 05:44:16 02871_clickhouse_client_restart_pager: [ OK ] 0.92 sec. 2026-03-19 05:44:16 02790_async_queries_in_query_log: [ OK ] 6.28 sec. 2026-03-19 05:44:18 02844_max_backup_bandwidth_s3: [ OK ] 30.23 sec. 2026-03-19 05:44:18 00763_long_lock_buffer_alter_destination_table: [ OK ] 33.00 sec. 2026-03-19 05:44:18 01273_arrow_load: [ OK ] 2.07 sec. 2026-03-19 05:44:19 00732_quorum_insert_simple_test_2_parts_zookeeper_long: [ OK ] 0.47 sec. 2026-03-19 05:44:19 01076_json_each_row_array: [ OK ] 0.97 sec. 2026-03-19 05:44:19 00502_string_concat_with_array: [ OK ] 0.27 sec. 2026-03-19 05:44:19 01798_having_push_down: [ OK ] 0.37 sec. 2026-03-19 05:44:19 01651_lc_insert_tiny_log_1: [ OK ] 2.73 sec. 2026-03-19 05:44:19 01246_extractAllGroupsVertical: [ OK ] 0.42 sec. 2026-03-19 05:44:19 02910_nullable_enum_cast: [ OK ] 0.32 sec. 2026-03-19 05:44:19 00910_buffer_prewhere: [ OK ] 0.32 sec. 2026-03-19 05:44:20 02346_fulltext_index_bug47393: [ OK ] 0.37 sec. 2026-03-19 05:44:20 02104_clickhouse_local_columns_description: [ OK ] 0.67 sec. 2026-03-19 05:44:21 01542_collate_in_array: [ OK ] 0.37 sec. 2026-03-19 05:44:21 01231_operator_null_in: [ OK ] 1.87 sec. 2026-03-19 05:44:21 02769_compare_functions_nan: [ OK ] 0.47 sec. 2026-03-19 05:44:22 01300_group_by_other_keys_having: [ OK ] 1.17 sec. 2026-03-19 05:44:22 02012_zookeeper_changed_enum_type: [ OK ] 0.37 sec. 2026-03-19 05:44:22 00739_array_element_nullable_string_mattrobenolt: [ OK ] 0.32 sec. 2026-03-19 05:44:22 00738_nested_merge_multidimensional_array: [ OK ] 0.32 sec. 2026-03-19 05:44:23 03199_unbin_buffer_overflow: [ OK ] 7.19 sec. 2026-03-19 05:44:23 01506_buffer_table_alter_block_structure: [ OK ] 0.37 sec. 2026-03-19 05:44:23 01944_insert_partition_by: [ OK ] 0.42 sec. 2026-03-19 05:44:23 01825_new_type_json_18: [ OK ] 0.32 sec. 2026-03-19 05:44:23 02764_index_analysis_fix: [ OK ] 0.37 sec. 2026-03-19 05:44:23 00449_filter_array_nullable_tuple: [ OK ] 0.32 sec. 2026-03-19 05:44:23 03217_fliter_pushdown_no_keys: [ OK ] 0.32 sec. 2026-03-19 05:44:23 03209_json_type_vertical_merges: [ SKIPPED ] 0.00 sec. 2026-03-19 05:44:23 Reason: not running for current build 2026-03-19 05:44:23 02184_storage_add_support_ttl: [ OK ] 0.37 sec. 2026-03-19 05:44:23 03057_analyzer_subquery_alias_join: [ OK ] 0.37 sec. 2026-03-19 05:44:24 00045_sorting_by_fixed_string_descending: [ OK ] 0.27 sec. 2026-03-19 05:44:24 01134_max_rows_to_group_by: [ OK ] 0.32 sec. 2026-03-19 05:44:24 00098_6_union_all: [ OK ] 0.27 sec. 2026-03-19 05:44:24 02479_mysql_connect_to_self: [ OK ] 0.64 sec. 2026-03-19 05:44:24 00337_shard_any_heavy: [ OK ] 0.32 sec. 2026-03-19 05:44:24 01020_having_without_group_by: [ OK ] 0.32 sec. 2026-03-19 05:44:25 03036_parquet_arrow_nullable: [ OK ] 5.88 sec. 2026-03-19 05:44:25 02010_lc_native: [ OK ] 1.67 sec. 2026-03-19 05:44:26 00516_deduplication_after_drop_partition_zookeeper: [ OK ] 0.47 sec. 2026-03-19 05:44:26 01214_test_storage_merge_aliases_with_where: [ OK ] 0.47 sec. 2026-03-19 05:44:27 02790_url_multiple_tsv_files: [ OK ] 1.02 sec. 2026-03-19 05:44:27 02346_to_hour_monotonicity_fix: [ OK ] 0.47 sec. 2026-03-19 05:44:28 00914_replicate: [ OK ] 0.32 sec. 2026-03-19 05:44:29 01077_mutations_index_consistency: [ OK ] 3.33 sec. 2026-03-19 05:44:29 02676_kafka_murmur_hash: [ OK ] 0.32 sec. 2026-03-19 05:44:30 03131_deprecated_functions: [ OK ] 0.42 sec. 2026-03-19 05:44:30 02266_auto_add_nullable: [ OK ] 0.27 sec. 2026-03-19 05:44:30 01383_log_broken_table: [ OK ] 25.14 sec. 2026-03-19 05:44:30 02973_dictionary_table_exception_fix: [ OK ] 0.32 sec. 2026-03-19 05:44:30 02122_parallel_formatting_JSONCompactStringsEachRowWithNames: [ OK ] 2.77 sec. 2026-03-19 05:44:31 02915_analyzer_fuzz_5: [ OK ] 0.32 sec. 2026-03-19 05:44:31 01505_pipeline_executor_UAF: [ OK ] 6.64 sec. 2026-03-19 05:44:31 03040_dynamic_type_alters_1_wide_merge_tree: [ OK ] 0.82 sec. 2026-03-19 05:44:31 02267_special_operator_parse_alias_check: [ OK ] 0.42 sec. 2026-03-19 05:44:32 02457_parse_date_time_best_effort: [ OK ] 0.42 sec. 2026-03-19 05:44:32 00357_to_string_complex_types: [ OK ] 0.32 sec. 2026-03-19 05:44:32 02210_processors_profile_log: [ OK ] 1.32 sec. 2026-03-19 05:44:32 01398_in_tuple_func: [ OK ] 0.32 sec. 2026-03-19 05:44:32 03039_unknown_identifier_window_function: [ OK ] 0.27 sec. 2026-03-19 05:44:32 02834_array_exists_segfault: [ OK ] 0.27 sec. 2026-03-19 05:44:32 02703_jit_external_aggregation: [ SKIPPED ] 0.00 sec. 2026-03-19 05:44:32 Reason: not running for current build 2026-03-19 05:44:32 02891_functions_over_sparse_columns: [ OK ] 0.32 sec. 2026-03-19 05:44:33 01949_heredoc_unfinished: [ OK ] 0.62 sec. 2026-03-19 05:44:33 02122_parallel_formatting_JSONStrings: [ OK ] 3.13 sec. 2026-03-19 05:44:34 00686_client_exit_code: [ OK ] 0.82 sec. 2026-03-19 05:44:36 02480_client_option_print_num_processed_rows: [ OK ] 2.08 sec. 2026-03-19 05:44:36 03199_merge_filters_bug: [ OK ] 0.37 sec. 2026-03-19 05:44:37 02995_forget_partition: [ OK ] 12.70 sec. 2026-03-19 05:44:37 01115_prewhere_array_join: [ OK ] 0.72 sec. 2026-03-19 05:44:37 02023_storage_filelog: [ OK ] 5.08 sec. 2026-03-19 05:44:38 01451_replicated_detach_drop_part_long: [ OK ] 0.62 sec. 2026-03-19 05:44:38 02454_set_parameters_formatting: [ OK ] 0.62 sec. 2026-03-19 05:44:38 03290_final_collapsing: [ OK ] 0.42 sec. 2026-03-19 05:44:38 00492_drop_temporary_table: [ OK ] 0.27 sec. 2026-03-19 05:44:38 00551_parse_or_null: [ OK ] 0.27 sec. 2026-03-19 05:44:38 03217_datetime64_constant_to_ast: [ OK ] 0.27 sec. 2026-03-19 05:44:38 00318_pk_tuple_order: [ OK ] 0.52 sec. 2026-03-19 05:44:38 02366_kql_create_table: [ OK ] 0.37 sec. 2026-03-19 05:44:39 00950_test_gorilla_codec: [ OK ] 0.37 sec. 2026-03-19 05:44:39 02932_parallel_replicas_fuzzer: [ OK ] 0.37 sec. 2026-03-19 05:44:39 02950_part_log_bytes_uncompressed: [ OK ] 0.37 sec. 2026-03-19 05:44:39 02931_alter_materialized_view_query_inconsistent: [ OK ] 0.27 sec. 2026-03-19 05:44:39 02186_range_hashed_dictionary_intersecting_intervals: [ OK ] 0.37 sec. 2026-03-19 05:44:39 03153_dynamic_type_empty: [ OK ] 0.32 sec. 2026-03-19 05:44:39 00472_create_view_if_not_exists: [ OK ] 0.22 sec. 2026-03-19 05:44:39 02564_read_in_order_final_desc: [ OK ] 0.32 sec. 2026-03-19 05:44:39 03038_recursive_cte_postgres_4: [ OK ] 0.37 sec. 2026-03-19 05:44:40 02703_max_local_read_bandwidth: [ OK ] 24.84 sec. 2026-03-19 05:44:40 02705_grouping_keys_equal_keys: [ OK ] 0.27 sec. 2026-03-19 05:44:40 03033_final_undefined_last_mark: [ OK ] 0.17 sec. 2026-03-19 05:44:40 00826_cross_to_inner_join: [ OK ] 0.57 sec. 2026-03-19 05:44:40 01262_low_cardinality_remove: [ OK ] 0.32 sec. 2026-03-19 05:44:40 01551_mergetree_read_in_order_spread: [ OK ] 0.32 sec. 2026-03-19 05:44:40 00534_functions_bad_arguments11: [ SKIPPED ] 0.00 sec. 2026-03-19 05:44:40 Reason: not running for current build 2026-03-19 05:44:40 01511_alter_version_versioned_collapsing_merge_tree: [ OK ] 0.37 sec. 2026-03-19 05:44:41 03041_dynamic_type_check_table: [ OK ] 7.74 sec. 2026-03-19 05:44:41 02461_alter_update_respect_part_column_type_bug: [ OK ] 0.97 sec. 2026-03-19 05:44:41 02267_output_format_prometheus: [ OK ] 0.37 sec. 2026-03-19 05:44:42 02681_comparsion_tuple_elimination_ast: [ OK ] 0.42 sec. 2026-03-19 05:44:42 01868_order_by_fill_with_datetime64: [ OK ] 0.37 sec. 2026-03-19 05:44:42 00719_insert_block_without_column: [ OK ] 1.77 sec. 2026-03-19 05:44:43 02311_normalize_utf8_constant: [ OK ] 0.32 sec. 2026-03-19 05:44:43 00109_shard_totals_after_having: [ OK ] 0.87 sec. 2026-03-19 05:44:43 02496_remove_redundant_sorting: [ OK ] 10.65 sec. 2026-03-19 05:44:43 03002_int_div_decimal_with_date_bug: [ OK ] 0.27 sec. 2026-03-19 05:44:43 02000_table_function_cluster_macros: [ OK ] 0.32 sec. 2026-03-19 05:44:43 00743_limit_by_not_found_column: [ OK ] 0.42 sec. 2026-03-19 05:44:43 02813_series_period_detect: [ OK ] 0.37 sec. 2026-03-19 05:44:43 00204_extract_url_parameter: [ OK ] 0.27 sec. 2026-03-19 05:44:43 02476_analyzer_join_with_unused_columns: [ OK ] 0.27 sec. 2026-03-19 05:44:44 00700_decimal_defaults: [ OK ] 0.27 sec. 2026-03-19 05:44:44 00134_aggregation_by_fixed_string_of_size_1_2_4_8: [ OK ] 0.32 sec. 2026-03-19 05:44:44 01300_wkt: [ OK ] 0.37 sec. 2026-03-19 05:44:44 01199_url_functions_path_without_schema_yiurule: [ OK ] 0.32 sec. 2026-03-19 05:44:44 02675_sparse_columns_clear_column: [ OK ] 0.32 sec. 2026-03-19 05:44:44 00604_show_create_database: [ OK ] 0.22 sec. 2026-03-19 05:44:44 02421_simple_queries_for_opentelemetry: [ OK ] 4.89 sec. 2026-03-19 05:44:44 02189_join_type_conversion: [ OK ] 0.27 sec. 2026-03-19 05:44:44 00054_join_string: [ OK ] 0.27 sec. 2026-03-19 05:44:44 02157_readonly_system_suspend: [ OK ] 0.77 sec. 2026-03-19 05:44:44 03207_json_read_subcolumns_2_wide_merge_tree: [ SKIPPED ] 0.00 sec. 2026-03-19 05:44:44 Reason: not running for current build 2026-03-19 05:44:45 02525_different_engines_in_temporary_tables: [ OK ] 0.37 sec. 2026-03-19 05:44:45 00981_in_subquery_with_tuple: [ OK ] 2.93 sec. 2026-03-19 05:44:45 02900_window_function_with_sparse_column: [ OK ] 0.32 sec. 2026-03-19 05:44:45 02810_row_binary_with_defaults: [ OK ] 0.32 sec. 2026-03-19 05:44:45 00338_replicate_array_of_strings: [ OK ] 0.37 sec. 2026-03-19 05:44:45 01552_dict_fixedstring: [ OK ] 0.27 sec. 2026-03-19 05:44:45 00292_parser_tuple_element: [ OK ] 0.27 sec. 2026-03-19 05:44:45 02336_sort_optimization_with_fill: [ OK ] 0.32 sec. 2026-03-19 05:44:45 02941_projections_external_aggregation: [ OK ] 0.87 sec. 2026-03-19 05:44:45 01720_union_distinct_with_limit: [ OK ] 0.32 sec. 2026-03-19 05:44:45 00368_format_option_collision: [ OK ] 0.87 sec. 2026-03-19 05:44:46 01096_block_serialized_state: [ OK ] 0.27 sec. 2026-03-19 05:44:46 01605_drop_settings_profile_while_assigned: [ OK ] 0.37 sec. 2026-03-19 05:44:46 02428_delete_with_settings: [ OK ] 0.47 sec. 2026-03-19 05:44:46 01666_date_lut_buffer_overflow: [ OK ] 0.27 sec. 2026-03-19 05:44:46 01532_having_with_totals: [ OK ] 0.37 sec. 2026-03-19 05:44:46 01255_geo_types_livace: [ OK ] 0.37 sec. 2026-03-19 05:44:47 00502_sum_map: [ OK ] 0.57 sec. 2026-03-19 05:44:47 01412_row_from_totals: [ OK ] 0.42 sec. 2026-03-19 05:44:47 01715_table_function_view_fix: [ OK ] 0.27 sec. 2026-03-19 05:44:47 02480_tets_show_full: [ OK ] 1.12 sec. 2026-03-19 05:44:48 02699_polygons_sym_difference_total: [ OK ] 0.27 sec. 2026-03-19 05:44:48 02932_kill_query_sleep: [ OK ] 2.82 sec. 2026-03-19 05:44:48 01107_tuples_arrays_parsing_exceptions: [ OK ] 0.97 sec. 2026-03-19 05:44:48 00411_merge_tree_where_const_in_set: [ OK ] 0.37 sec. 2026-03-19 05:44:48 01284_view_and_extremes_bug: [ OK ] 0.27 sec. 2026-03-19 05:44:48 02809_has_subsequence: [ OK ] 0.47 sec. 2026-03-19 05:44:48 02515_projections_with_totals: [ OK ] 0.32 sec. 2026-03-19 05:44:48 00394_new_nested_column_keeps_offsets: [ OK ] 0.37 sec. 2026-03-19 05:44:49 03214_count_distinct_null_key_memory_leak: [ OK ] 1.87 sec. 2026-03-19 05:44:49 03352_distinct_sorted_bug: [ OK ] 0.27 sec. 2026-03-19 05:44:49 03237_max_map_state_decimal_serialization: [ OK ] 0.27 sec. 2026-03-19 05:44:49 03036_dynamic_read_subcolumns_memory: [ OK ] 1.17 sec. 2026-03-19 05:44:49 02592_avro_records_with_same_names: [ OK ] 0.72 sec. 2026-03-19 05:44:49 00804_test_alter_compression_codecs: [ OK ] 3.68 sec. 2026-03-19 05:44:49 02788_current_schemas_function: [ OK ] 0.27 sec. 2026-03-19 05:44:49 00370_duplicate_columns_in_subqueries: [ OK ] 0.32 sec. 2026-03-19 05:44:50 02681_aggregation_by_partitions_bug: [ OK ] 0.47 sec. 2026-03-19 05:44:50 02992_analyzer_group_by_const: [ OK ] 0.57 sec. 2026-03-19 05:44:50 01825_new_type_json_nbagames: [ OK ] 9.90 sec. 2026-03-19 05:44:50 01045_bloom_filter_null_array: [ OK ] 0.37 sec. 2026-03-19 05:44:50 02332_dist_insert_send_logs_level: [ OK ] 1.12 sec. 2026-03-19 05:44:50 02705_settings_check_changed_flag: [ OK ] 0.52 sec. 2026-03-19 05:44:50 01119_session_log: [ OK ] 30.80 sec. 2026-03-19 05:44:50 02192_comment: [ OK ] 0.27 sec. 2026-03-19 05:44:50 00649_quantile_tdigest_negative: [ OK ] 0.27 sec. 2026-03-19 05:44:50 01018_ddl_dictionaries_special: [ OK ] 0.52 sec. 2026-03-19 05:44:50 02231_hierarchical_dictionaries_constant: [ OK ] 0.37 sec. 2026-03-19 05:44:50 01651_map_functions: [ OK ] 0.72 sec. 2026-03-19 05:44:50 00585_union_all_subquery_aggregation_column_removal: [ OK ] 0.37 sec. 2026-03-19 05:44:51 01891_partition_by_uuid: [ OK ] 0.27 sec. 2026-03-19 05:44:51 02291_dictionary_scalar_subquery_reload: [ OK ] 0.42 sec. 2026-03-19 05:44:51 00702_join_on_dups: [ OK ] 0.62 sec. 2026-03-19 05:44:51 01701_clear_projection_and_part_remove: [ OK ] 0.32 sec. 2026-03-19 05:44:51 03209_parameterized_view_with_non_literal_params: [ OK ] 0.62 sec. 2026-03-19 05:44:51 02800_clickhouse_local_default_settings: [ OK ] 0.67 sec. 2026-03-19 05:44:51 03003_count_asterisk_filter: [ OK ] 0.27 sec. 2026-03-19 05:44:51 00909_ngram_distance: [ OK ] 1.02 sec. 2026-03-19 05:44:51 02842_filesystem_cache_validate_path: [ OK ] 0.37 sec. 2026-03-19 05:44:51 01700_mod_negative_type_promotion: [ OK ] 0.27 sec. 2026-03-19 05:44:52 02366_window_function_order_by: [ OK ] 0.27 sec. 2026-03-19 05:44:52 00426_nulls_sorting: [ OK ] 0.42 sec. 2026-03-19 05:44:52 02998_analyzer_secret_args_tree_node: [ OK ] 0.27 sec. 2026-03-19 05:44:52 00590_limit_by_column_removal: [ OK ] 0.27 sec. 2026-03-19 05:44:52 00700_decimal_math: [ OK ] 0.47 sec. 2026-03-19 05:44:52 02981_vertical_merges_memory_usage: [ OK ] 1.57 sec. 2026-03-19 05:44:52 02967_fuzz_bad_cast: [ OK ] 0.32 sec. 2026-03-19 05:44:53 02457_morton_coding: [ OK ] 0.67 sec. 2026-03-19 05:44:53 02513_prewhere_combine_step_filters: [ OK ] 0.37 sec. 2026-03-19 05:44:53 01475_fix_bigint_shift: [ OK ] 0.32 sec. 2026-03-19 05:44:53 02974_if_with_map: [ OK ] 0.37 sec. 2026-03-19 05:44:54 02972_insert_deduplication_token_hierarchical_inserts_views: [ OK ] 3.58 sec. 2026-03-19 05:44:54 00120_join_and_group_by: [ OK ] 0.27 sec. 2026-03-19 05:44:54 02158_ztest: [ OK ] 0.32 sec. 2026-03-19 05:44:55 02372_now_in_block: [ OK ] 0.67 sec. 2026-03-19 05:44:55 02122_parallel_formatting_JSON: [ OK ] 2.47 sec. 2026-03-19 05:44:55 00276_sample: [ OK ] 1.22 sec. 2026-03-19 05:44:55 02771_skip_empty_files: [ OK ] 2.42 sec. 2026-03-19 05:44:55 03080_analyzer_prefer_column_name_to_alias__virtual_columns: [ OK ] 0.32 sec. 2026-03-19 05:44:55 03240_insert_select_named_tuple: [ OK ] 0.42 sec. 2026-03-19 05:44:55 01103_check_cpu_instructions_at_startup: [ SKIPPED ] 0.00 sec. 2026-03-19 05:44:55 Reason: not running for current build 2026-03-19 05:44:55 00732_quorum_insert_lost_part_zookeeper_long: [ OK ] 0.47 sec. 2026-03-19 05:44:56 02131_used_row_policies_in_query_log: [ OK ] 0.52 sec. 2026-03-19 05:44:56 02122_parallel_formatting_PrettyNoEscapes: [ OK ] 3.98 sec. 2026-03-19 05:44:56 00688_low_cardinality_dictionary_deserialization: [ OK ] 0.97 sec. 2026-03-19 05:44:56 02287_ephemeral_format_crash: [ OK ] 0.32 sec. 2026-03-19 05:44:56 00530_arrays_of_nothing: [ OK ] 0.32 sec. 2026-03-19 05:44:56 00647_select_numbers_with_offset: [ OK ] 0.27 sec. 2026-03-19 05:44:56 02176_dict_get_has_implicit_key_cast: [ OK ] 0.58 sec. 2026-03-19 05:44:56 02490_replacing_merge_tree_is_deleted_column_transform_opt: [ OK ] 0.72 sec. 2026-03-19 05:44:56 00746_sql_fuzzy: [ OK ] 57.92 sec. 2026-03-19 05:44:56 03150_dynamic_type_mv_insert: [ OK ] 0.42 sec. 2026-03-19 05:44:56 03116_analyzer_explicit_alias_as_column_name: [ OK ] 0.27 sec. 2026-03-19 05:44:57 02265_per_table_ttl_mutation_on_change: [ OK ] 0.42 sec. 2026-03-19 05:44:57 03174_multiple_authentication_methods: [ OK ] 5.83 sec. 2026-03-19 05:44:57 02910_replicated_merge_parameters_must_consistent: [ OK ] 0.58 sec. 2026-03-19 05:44:58 01854_HTTP_dict_decompression: [ OK ] 1.02 sec. 2026-03-19 05:44:58 01375_null_issue_3767: [ OK ] 0.27 sec. 2026-03-19 05:44:58 02381_compress_marks_and_primary_key: [ OK ] 1.52 sec. 2026-03-19 05:44:58 02967_parallel_replicas_joins_and_analyzer: [ OK ] 1.67 sec. 2026-03-19 05:44:58 03038_nested_dynamic_merges_compact_horizontal: [ OK ] 2.37 sec. 2026-03-19 05:44:58 03251_unaligned_window_function_state: [ OK ] 0.37 sec. 2026-03-19 05:44:58 01060_window_view_event_tumble_to_asc: [ OK ] 2.22 sec. 2026-03-19 05:44:58 02725_alias_columns_should_not_allow_compression_codec: [ OK ] 0.37 sec. 2026-03-19 05:44:58 00814_parsing_ub: [ OK ] 0.32 sec. 2026-03-19 05:44:58 00154_shard_distributed_with_distinct: [ OK ] 0.37 sec. 2026-03-19 05:44:59 02367_analyzer_table_alias_columns: [ OK ] 0.42 sec. 2026-03-19 05:44:59 01662_test_toDayOfMonth_mysql_compatibility: [ OK ] 0.32 sec. 2026-03-19 05:44:59 02049_clickhouse_local_merge_tree: [ OK ] 0.92 sec. 2026-03-19 05:44:59 03152_trailing_comma_in_columns_list_in_insert: [ OK ] 0.27 sec. 2026-03-19 05:44:59 01049_zookeeper_synchronous_mutations_long: [ OK ] 0.57 sec. 2026-03-19 05:44:59 01259_combinator_distinct: [ OK ] 0.32 sec. 2026-03-19 05:44:59 02915_analyzer_fuzz_1: [ OK ] 0.37 sec. 2026-03-19 05:45:00 00960_eval_ml_method_const: [ OK ] 0.27 sec. 2026-03-19 05:45:00 02931_size_virtual_column_use_structure_from_insertion_table: [ OK ] 0.67 sec. 2026-03-19 05:45:00 01656_sequence_next_node_long: [ OK ] 2.27 sec. 2026-03-19 05:45:00 02181_dictionary_attach_detach: [ OK ] 0.42 sec. 2026-03-19 05:45:00 02493_analyzer_sum_if_to_count_if: [ OK ] 0.32 sec. 2026-03-19 05:45:00 01660_join_or_all: [ OK ] 0.67 sec. 2026-03-19 05:45:01 01442_date_time_with_params: [ OK ] 0.87 sec. 2026-03-19 05:45:01 02962_join_using_bug_57894: [ OK ] 0.37 sec. 2026-03-19 05:45:01 02876_s3_cluster_schema_inference_names_with_spaces: [ OK ] 0.32 sec. 2026-03-19 05:45:01 02842_one_input_format: [ OK ] 1.92 sec. 2026-03-19 05:45:01 01746_long_zlib_http_compression_json_format: [ OK ] 0.72 sec. 2026-03-19 05:45:01 01825_type_json_partitions: [ OK ] 0.42 sec. 2026-03-19 05:45:01 01892_setting_limit_offset_distributed: [ OK ] 0.32 sec. 2026-03-19 05:45:02 03215_toStartOfWeek_with_dateTime64_fix: [ OK ] 0.27 sec. 2026-03-19 05:45:02 02596_build_set_and_remote: [ OK ] 0.52 sec. 2026-03-19 05:45:02 00650_csv_with_specified_quote_rule: [ OK ] 4.93 sec. 2026-03-19 05:45:02 00757_enum_defaults_const_analyzer: [ OK ] 0.27 sec. 2026-03-19 05:45:03 00422_hash_function_constexpr: [ OK ] 0.27 sec. 2026-03-19 05:45:03 02984_form_format: [ OK ] 1.72 sec. 2026-03-19 05:45:03 01595_countMatches: [ OK ] 0.37 sec. 2026-03-19 05:45:03 03032_save_bad_json_escape_sequences: [ OK ] 0.32 sec. 2026-03-19 05:45:03 03006_buffer_overflow_join: [ OK ] 0.37 sec. 2026-03-19 05:45:03 01902_table_function_merge_db_params: [ OK ] 0.47 sec. 2026-03-19 05:45:03 01891_not_like_partition_prune: [ OK ] 0.37 sec. 2026-03-19 05:45:04 00053_all_inner_join: [ OK ] 0.27 sec. 2026-03-19 05:45:04 02539_vertical_merge_compact_parts: [ OK ] 0.52 sec. 2026-03-19 05:45:04 02480_suspicious_lowcard_in_key: [ OK ] 0.38 sec. 2026-03-19 05:45:04 02004_max_hyperscan_regex_length: [ SKIPPED ] 0.00 sec. 2026-03-19 05:45:04 Reason: not running for current build 2026-03-19 05:45:04 01553_datetime64_comparison: [ OK ] 0.32 sec. 2026-03-19 05:45:04 02020_exponential_smoothing: [ OK ] 0.92 sec. 2026-03-19 05:45:04 01016_macros: [ OK ] 0.37 sec. 2026-03-19 05:45:05 02998_to_milliseconds: [ OK ] 0.37 sec. 2026-03-19 05:45:05 03037_dot_product_overflow: [ OK ] 0.27 sec. 2026-03-19 05:45:05 00903_array_with_constant_function: [ OK ] 0.27 sec. 2026-03-19 05:45:05 03155_explain_current_transaction: [ OK ] 0.27 sec. 2026-03-19 05:45:05 02244_make_datetime: [ OK ] 0.47 sec. 2026-03-19 05:45:05 01423_if_nullable_cond: [ OK ] 0.27 sec. 2026-03-19 05:45:05 01098_msgpack_format: [ OK ] 14.61 sec. 2026-03-19 05:45:05 01666_lcm_ubsan: [ OK ] 0.42 sec. 2026-03-19 05:45:06 02840_merge__table_or_filter: [ OK ] 0.42 sec. 2026-03-19 05:45:06 00760_insert_json_with_defaults: [ OK ] 0.42 sec. 2026-03-19 05:45:07 00267_tuple_array_access_operators_priority: [ OK ] 0.32 sec. 2026-03-19 05:45:07 01710_projection_external_aggregate: [ OK ] 0.37 sec. 2026-03-19 05:45:07 02789_jit_cannot_convert_column: [ OK ] 0.27 sec. 2026-03-19 05:45:08 02315_pmj_union_ubsan_35857: [ OK ] 0.27 sec. 2026-03-19 05:45:08 03207_json_read_subcolumns_1_compact_merge_tree: [ OK ] 2.47 sec. 2026-03-19 05:45:08 01664_decimal_ubsan: [ OK ] 0.27 sec. 2026-03-19 05:45:08 02319_sql_standard_create_drop_index: [ OK ] 0.42 sec. 2026-03-19 05:45:08 02661_read_from_archive_targz: [ OK ] 9.44 sec. 2026-03-19 05:45:09 02791_final_block_structure_mismatch_bug: [ OK ] 0.62 sec. 2026-03-19 05:45:09 01670_test_repeat_mysql_dialect: [ OK ] 0.27 sec. 2026-03-19 05:45:09 00674_join_on_syntax: [ OK ] 0.97 sec. 2026-03-19 05:45:09 00098_a_union_all: [ OK ] 0.32 sec. 2026-03-19 05:45:09 01107_join_right_table_totals: [ OK ] 0.47 sec. 2026-03-19 05:45:10 02995_preliminary_filters_duplicated_columns: [ OK ] 0.32 sec. 2026-03-19 05:45:10 01663_test_toDate_mysql_compatibility: [ OK ] 0.27 sec. 2026-03-19 05:45:10 00443_optimize_final_vertical_merge: [ OK ] 5.58 sec. 2026-03-19 05:45:10 02907_preferred_optimize_projection_name: [ OK ] 4.88 sec. 2026-03-19 05:45:10 01040_h3_get_resolution: [ OK ] 0.27 sec. 2026-03-19 05:45:10 02582_async_reading_with_small_limit: [ OK ] 0.32 sec. 2026-03-19 05:45:11 02817_structure_to_schema: [ OK ] 9.64 sec. 2026-03-19 05:45:11 00754_alter_modify_column_partitions: [ OK ] 0.47 sec. 2026-03-19 05:45:11 02402_merge_engine_with_view: [ OK ] 0.32 sec. 2026-03-19 05:45:11 00062_replicated_merge_tree_alter_zookeeper_long: [ OK ] 0.87 sec. 2026-03-19 05:45:11 02534_parquet_fixed_binary_array: [ OK ] 2.02 sec. 2026-03-19 05:45:12 02592_avro_more_types: [ OK ] 0.82 sec. 2026-03-19 05:45:12 00458_merge_type_cast: [ OK ] 0.57 sec. 2026-03-19 05:45:12 02475_precise_decimal_arithmetics: [ OK ] 0.47 sec. 2026-03-19 05:45:12 00334_column_aggregate_function_limit: [ OK ] 0.32 sec. 2026-03-19 05:45:12 03019_numbers_pretty: [ OK ] 0.32 sec. 2026-03-19 05:45:13 03169_modify_column_data_loss: [ OK ] 0.37 sec. 2026-03-19 05:45:13 00328_long_case_construction: [ OK ] 14.46 sec. 2026-03-19 05:45:13 03038_nested_dynamic_merges_compact_vertical: [ OK ] 2.43 sec. 2026-03-19 05:45:13 01505_log_distributed_deadlock: [ OK ] 0.27 sec. 2026-03-19 05:45:13 01600_min_max_compress_block_size: [ OK ] 0.27 sec. 2026-03-19 05:45:13 02931_file_cluster: [ OK ] 0.77 sec. 2026-03-19 05:45:13 02458_key_condition_not_like_prefix: [ OK ] 0.32 sec. 2026-03-19 05:45:13 00262_alter_alias: [ OK ] 0.37 sec. 2026-03-19 05:45:13 02158_ztest_cmp: [ OK ] 1.57 sec. 2026-03-19 05:45:13 00988_constraints_replication_zookeeper_long: [ OK ] 0.47 sec. 2026-03-19 05:45:14 01946_profile_sleep: [ OK ] 1.02 sec. 2026-03-19 05:45:14 01505_trivial_count_with_partition_predicate: [ OK ] 0.57 sec. 2026-03-19 05:45:14 02301_harmful_reexec: [ OK ] 0.72 sec. 2026-03-19 05:45:14 02494_analyzer_compound_expression_crash_fix: [ OK ] 0.27 sec. 2026-03-19 05:45:14 03058_analyzer_ambiguous_columns: [ OK ] 0.42 sec. 2026-03-19 05:45:14 01155_old_mutation_parts_to_do: [ OK ] 13.05 sec. 2026-03-19 05:45:14 01507_transform_null_in: [ OK ] 0.27 sec. 2026-03-19 05:45:15 02875_fix_column_decimal_serialization: [ OK ] 0.32 sec. 2026-03-19 05:45:15 03247_generic_arrayMin_arrayMax_fixes: [ OK ] 0.37 sec. 2026-03-19 05:45:15 02158_proportions_ztest: [ OK ] 0.32 sec. 2026-03-19 05:45:15 00339_parsing_bad_arrays: [ OK ] 0.62 sec. 2026-03-19 05:45:15 00007_array: [ OK ] 0.27 sec. 2026-03-19 05:45:15 01079_bad_alters_zookeeper_long: [ OK ] 6.79 sec. 2026-03-19 05:45:15 00688_low_cardinality_serialization: [ OK ] 2.13 sec. 2026-03-19 05:45:15 02021_h3_is_res_classIII: [ OK ] 0.32 sec. 2026-03-19 05:45:15 00088_distinct_of_arrays_of_strings: [ OK ] 0.32 sec. 2026-03-19 05:45:16 02366_kql_distinct: [ OK ] 0.32 sec. 2026-03-19 05:45:16 02815_first_line: [ OK ] 0.32 sec. 2026-03-19 05:45:16 02517_avro_bool_type: [ OK ] 0.72 sec. 2026-03-19 05:45:16 00610_materialized_view_forward_alter_partition_statements: [ OK ] 0.42 sec. 2026-03-19 05:45:16 00937_test_use_header_csv: [ OK ] 4.58 sec. 2026-03-19 05:45:16 02845_parquet_odd_decimals: [ OK ] 1.67 sec. 2026-03-19 05:45:16 02370_analyzer_in_function: [ OK ] 0.42 sec. 2026-03-19 05:45:16 00534_functions_bad_arguments4_long: [ SKIPPED ] 0.00 sec. 2026-03-19 05:45:16 Reason: not running for current build 2026-03-19 05:45:17 02594_msgpack_more_types: [ OK ] 0.87 sec. 2026-03-19 05:45:17 01889_clickhouse_client_config_format: [ OK ] 1.72 sec. 2026-03-19 05:45:17 00653_monotonic_integer_cast: [ OK ] 0.27 sec. 2026-03-19 05:45:17 00521_multidimensional: [ OK ] 0.57 sec. 2026-03-19 05:45:17 02510_group_by_prewhere_null: [ OK ] 0.27 sec. 2026-03-19 05:45:17 02113_base64encode_trailing_bytes_1: [ OK ] 0.27 sec. 2026-03-19 05:45:17 01084_regexp_empty: [ OK ] 0.27 sec. 2026-03-19 05:45:17 01070_string_to_h3: [ OK ] 0.27 sec. 2026-03-19 05:45:17 02861_alter_replace_partition_do_not_wait_mutations_on_unrelated_partitions: [ OK ] 3.78 sec. 2026-03-19 05:45:17 03262_udf_in_constraint: [ OK ] 0.82 sec. 2026-03-19 05:45:17 03142_skip_ANSI_in_UTF8_compute_width: [ OK ] 0.27 sec. 2026-03-19 05:45:17 02999_scalar_subqueries_bug_2: [ OK ] 0.27 sec. 2026-03-19 05:45:17 02967_analyzer_fuzz: [ OK ] 0.32 sec. 2026-03-19 05:45:17 01881_join_on_conditions_merge: [ OK ] 1.27 sec. 2026-03-19 05:45:17 02100_now64_types_bug: [ OK ] 0.37 sec. 2026-03-19 05:45:17 03171_hashed_dictionary_short_circuit_bug_fix: [ OK ] 0.33 sec. 2026-03-19 05:45:17 01268_mergine_sorted_limit: [ OK ] 0.27 sec. 2026-03-19 05:45:17 01354_order_by_tuple_collate_const: [ OK ] 0.32 sec. 2026-03-19 05:45:18 02096_totals_global_in_bug: [ OK ] 0.37 sec. 2026-03-19 05:45:18 01548_create_table_compound_column_format: [ OK ] 0.67 sec. 2026-03-19 05:45:18 03066_analyzer_global_with_statement: [ OK ] 0.27 sec. 2026-03-19 05:45:18 02982_unambiguous_alter_commands: [ OK ] 0.32 sec. 2026-03-19 05:45:18 00617_array_in: [ OK ] 0.32 sec. 2026-03-19 05:45:18 01540_verbatim_partition_pruning: [ OK ] 0.37 sec. 2026-03-19 05:45:18 02843_date_predicate_optimizations_bugs: [ OK ] 0.27 sec. 2026-03-19 05:45:18 02539_generate_random_ip: [ OK ] 0.27 sec. 2026-03-19 05:45:18 01925_json_as_string_data_in_square_brackets: [ OK ] 0.37 sec. 2026-03-19 05:45:18 01652_ttl_old_syntax: [ OK ] 0.37 sec. 2026-03-19 05:45:18 02111_with_fill_no_rows: [ OK ] 0.32 sec. 2026-03-19 05:45:18 02571_local_desc_abort_on_twitter_json: [ OK ] 0.77 sec. 2026-03-19 05:45:18 01532_tuple_with_name_type: [ OK ] 0.37 sec. 2026-03-19 05:45:18 01825_new_type_json_bools: [ OK ] 0.32 sec. 2026-03-19 05:45:18 02045_like_function: [ OK ] 0.27 sec. 2026-03-19 05:45:18 00448_to_string_cut_to_zero: [ OK ] 0.27 sec. 2026-03-19 05:45:19 01746_extract_text_from_html: [ OK ] 0.42 sec. 2026-03-19 05:45:19 02389_analyzer_nested_lambda: [ OK ] 3.58 sec. 2026-03-19 05:45:19 01074_h3_range_check: [ OK ] 0.32 sec. 2026-03-19 05:45:19 03164_parallel_replicas_range_filter_min_max: [ OK ] 0.57 sec. 2026-03-19 05:45:19 01509_dictionary_preallocate: [ OK ] 0.87 sec. 2026-03-19 05:45:19 03119_analyzer_window_function_in_CTE_alias: [ OK ] 0.37 sec. 2026-03-19 05:45:19 01767_timezoneOf: [ OK ] 0.67 sec. 2026-03-19 05:45:19 03641_analyzer_issue_85834: [ OK ] 0.27 sec. 2026-03-19 05:45:19 00014_select_from_table_with_nested: [ OK ] 0.32 sec. 2026-03-19 05:45:19 00534_functions_bad_arguments7: [ SKIPPED ] 0.00 sec. 2026-03-19 05:45:19 Reason: not running for current build 2026-03-19 05:45:19 02179_range_hashed_dictionary_invalid_interval: [ OK ] 0.37 sec. 2026-03-19 05:45:20 00997_trim: [ OK ] 0.57 sec. 2026-03-19 05:45:20 02097_polygon_dictionary_store_key: [ OK ] 0.37 sec. 2026-03-19 05:45:20 01387_clear_column_default_depends: [ OK ] 0.42 sec. 2026-03-19 05:45:20 01345_array_join_LittleMaverick: [ OK ] 0.32 sec. 2026-03-19 05:45:20 01038_array_of_unnamed_tuples: [ OK ] 0.32 sec. 2026-03-19 05:45:20 02304_grouping_set_order_by: [ OK ] 0.27 sec. 2026-03-19 05:45:20 01013_hex_float: [ OK ] 0.32 sec. 2026-03-19 05:45:20 00098_1_union_all: [ OK ] 0.27 sec. 2026-03-19 05:45:20 03068_analyzer_distributed_join: [ OK ] 0.42 sec. 2026-03-19 05:45:21 01901_in_literal_shard_prune: [ OK ] 0.32 sec. 2026-03-19 05:45:21 02043_user_defined_executable_function_implicit_cast: [ OK ] 0.57 sec. 2026-03-19 05:45:21 01651_lc_insert_tiny_log_3: [ OK ] 3.28 sec. 2026-03-19 05:45:21 03100_analyzer_constants_in_multiif: [ OK ] 0.27 sec. 2026-03-19 05:45:21 00851_http_insert_json_defaults: [ OK ] 1.67 sec. 2026-03-19 05:45:22 00619_union_highlite: [ OK ] 0.37 sec. 2026-03-19 05:45:22 02943_tokenbf_and_ngrambf_indexes_support_match_function: [ OK ] 0.42 sec. 2026-03-19 05:45:22 01353_neighbor_overflow: [ OK ] 0.27 sec. 2026-03-19 05:45:22 01657_array_element_ubsan: [ OK ] 0.32 sec. 2026-03-19 05:45:22 02994_sanity_check_settings: [ OK ] 0.32 sec. 2026-03-19 05:45:22 01527_bad_aggregation_in_lambda: [ OK ] 0.27 sec. 2026-03-19 05:45:22 02295_GROUP_BY_AggregateFunction: [ OK ] 0.52 sec. 2026-03-19 05:45:22 00500_point_in_polygon_non_const_poly: [ OK ] 0.87 sec. 2026-03-19 05:45:23 00029_test_zookeeper_optimize_exception: [ OK ] 4.14 sec. 2026-03-19 05:45:23 03015_with_fill_invalid_expression: [ OK ] 0.32 sec. 2026-03-19 05:45:23 02540_analyzer_matcher_alias_materialized_columns: [ OK ] 0.32 sec. 2026-03-19 05:45:23 02275_full_sort_join_long: [ SKIPPED ] 0.00 sec. 2026-03-19 05:45:23 Reason: not running for current build 2026-03-19 05:45:23 02579_fill_empty_chunk_analyzer: [ OK ] 0.32 sec. 2026-03-19 05:45:23 03142_alter_comment_parameterized_view: [ OK ] 0.32 sec. 2026-03-19 05:45:23 01927_query_views_log_matview_exceptions: [ OK ] 4.18 sec. 2026-03-19 05:45:24 00513_fractional_time_zones: [ OK ] 0.27 sec. 2026-03-19 05:45:24 02520_group_array_last: [ OK ] 0.52 sec. 2026-03-19 05:45:24 02474_extract_fixedstring_from_json: [ OK ] 0.42 sec. 2026-03-19 05:45:24 02590_interserver_mode_client_info_initial_query_start_time: [ OK ] 6.39 sec. 2026-03-19 05:45:24 00926_adaptive_index_granularity_merge_tree: [ OK ] 1.23 sec. 2026-03-19 05:45:25 01710_normal_projection_format: [ OK ] 0.27 sec. 2026-03-19 05:45:25 00159_whitespace_in_columns_list: [ OK ] 0.27 sec. 2026-03-19 05:45:25 01472_toBoundsOfInterval_disallow_empty_tz_field: [ OK ] 0.62 sec. 2026-03-19 05:45:25 00157_aliases_and_lambda_formal_parameters: [ OK ] 0.27 sec. 2026-03-19 05:45:25 01318_map_populate_series: [ OK ] 0.47 sec. 2026-03-19 05:45:25 02832_transform_fixed_string_no_default: [ OK ] 0.27 sec. 2026-03-19 05:45:26 00972_geohashesInBox: [ OK ] 0.67 sec. 2026-03-19 05:45:26 01825_type_json_schema_inference: [ OK ] 3.03 sec. 2026-03-19 05:45:26 01601_proxy_protocol: [ OK ] 0.62 sec. 2026-03-19 05:45:26 00048_a_stored_aggregates_merge: [ OK ] 0.32 sec. 2026-03-19 05:45:26 03209_json_type_horizontal_merges: [ SKIPPED ] 0.00 sec. 2026-03-19 05:45:26 Reason: not running for current build 2026-03-19 05:45:27 01822_short_circuit: [ OK ] 1.02 sec. 2026-03-19 05:45:27 01460_mark_inclusion_search_crash: [ OK ] 0.32 sec. 2026-03-19 05:45:27 02246_flatten_tuple: [ OK ] 0.37 sec. 2026-03-19 05:45:27 02834_timestamp_function: [ OK ] 0.47 sec. 2026-03-19 05:45:27 02972_insert_deduplication_token_hierarchical_inserts: [ OK ] 3.68 sec. 2026-03-19 05:45:28 02885_create_distributed_table_without_as: [ OK ] 0.27 sec. 2026-03-19 05:45:28 02134_async_inserts_formats: [ OK ] 6.84 sec. 2026-03-19 05:45:28 01634_sum_map_nulls: [ OK ] 0.27 sec. 2026-03-19 05:45:28 02864_profile_event_part_lock: [ OK ] 0.37 sec. 2026-03-19 05:45:28 03143_group_by_constant_secondary: [ OK ] 0.27 sec. 2026-03-19 05:45:28 01710_normal_projections: [ OK ] 5.89 sec. 2026-03-19 05:45:28 02423_insert_stats_behaviour: [ OK ] 3.64 sec. 2026-03-19 05:45:28 02911_analyzer_explain_estimate: [ OK ] 0.27 sec. 2026-03-19 05:45:29 02688_aggregate_states: [ OK ] 0.42 sec. 2026-03-19 05:45:29 00275_shard_quantiles_weighted: [ OK ] 0.52 sec. 2026-03-19 05:45:29 01812_has_generic: [ OK ] 0.37 sec. 2026-03-19 05:45:29 03011_adaptative_timeout_compatibility: [ OK ] 0.32 sec. 2026-03-19 05:45:29 02122_parallel_formatting_Values: [ OK ] 2.02 sec. 2026-03-19 05:45:29 02842_table_function_file_filter_by_virtual_columns: [ OK ] 0.82 sec. 2026-03-19 05:45:29 01736_null_as_default: [ OK ] 0.32 sec. 2026-03-19 05:45:29 01514_input_format_json_enum_as_number: [ OK ] 0.27 sec. 2026-03-19 05:45:29 02995_index_3: [ SKIPPED ] 0.00 sec. 2026-03-19 05:45:29 Reason: not running for current build 2026-03-19 05:45:30 00228_shard_quantiles_deterministic_merge_overflow: [ OK ] 0.32 sec. 2026-03-19 05:45:30 00353_join_by_tuple: [ OK ] 0.32 sec. 2026-03-19 05:45:30 02439_merge_selecting_partitions: [ OK ] 4.08 sec. 2026-03-19 05:45:30 01906_bigint_accurate_cast_ubsan: [ OK ] 0.62 sec. 2026-03-19 05:45:30 01104_distributed_numbers_test: [ OK ] 0.32 sec. 2026-03-19 05:45:30 01602_runningConcurrency: [ OK ] 0.47 sec. 2026-03-19 05:45:30 00835_if_generic_case: [ OK ] 0.37 sec. 2026-03-19 05:45:30 02716_int256_arrayfunc: [ OK ] 0.32 sec. 2026-03-19 05:45:30 02574_suspicious_low_cardinality_msan: [ OK ] 0.42 sec. 2026-03-19 05:45:30 00844_join_lightee2: [ OK ] 0.32 sec. 2026-03-19 05:45:30 00538_datediff_plural_units: [ OK ] 0.42 sec. 2026-03-19 05:45:30 02165_h3_num_hexagons: [ OK ] 0.37 sec. 2026-03-19 05:45:31 01225_drop_dictionary_as_table: [ OK ] 0.27 sec. 2026-03-19 05:45:31 03006_join_on_inequal_expression_2: [ OK ] 1.12 sec. 2026-03-19 05:45:31 01518_filtering_aliased_materialized_column: [ OK ] 0.27 sec. 2026-03-19 05:45:31 00725_memory_tracking: [ OK ] 0.72 sec. 2026-03-19 05:45:31 02347_rank_corr_nan: [ OK ] 0.22 sec. 2026-03-19 05:45:31 03161_decimal_binary_math: [ OK ] 0.77 sec. 2026-03-19 05:45:31 02053_INSERT_SELECT_MATERIALIZED: [ OK ] 0.27 sec. 2026-03-19 05:45:31 02454_compressed_marks_in_compact_part: [ OK ] 0.32 sec. 2026-03-19 05:45:31 01457_int256_hashing: [ OK ] 0.42 sec. 2026-03-19 05:45:32 02242_if_then_else_null_bug: [ OK ] 0.27 sec. 2026-03-19 05:45:32 02181_sql_user_defined_functions_invalid_lambda: [ OK ] 0.27 sec. 2026-03-19 05:45:32 01149_zookeeper_mutation_stuck_after_replace_partition: [ OK ] 0.77 sec. 2026-03-19 05:45:32 01661_week_functions_string_args: [ OK ] 0.62 sec. 2026-03-19 05:45:33 00632_aggregation_window_funnel: [ OK ] 0.97 sec. 2026-03-19 05:45:33 02874_array_random_sample: [ OK ] 5.63 sec. 2026-03-19 05:45:33 00497_whitespaces_in_insert: [ OK ] 4.28 sec. 2026-03-19 05:45:33 03031_tuple_elimination_analyzer: [ OK ] 0.42 sec. 2026-03-19 05:45:33 02508_index_analysis_to_date_timezone: [ OK ] 0.37 sec. 2026-03-19 05:45:33 00230_array_functions_has_count_equal_index_of_non_const_second_arg: [ OK ] 0.52 sec. 2026-03-19 05:45:34 01825_new_type_json_3: [ OK ] 0.72 sec. 2026-03-19 05:45:34 02149_schema_inference: [ OK ] 14.01 sec. 2026-03-19 05:45:34 01670_distributed_bytes_to_throw_insert: [ OK ] 0.37 sec. 2026-03-19 05:45:35 01183_custom_separated_format_http: [ OK ] 3.28 sec. 2026-03-19 05:45:35 02096_date_time_1970_saturation: [ OK ] 0.42 sec. 2026-03-19 05:45:35 00445_join_nullable_keys: [ OK ] 0.32 sec. 2026-03-19 05:45:35 02151_http_s_structure_set_eof: [ OK ] 1.62 sec. 2026-03-19 05:45:35 01822_union_and_constans_error: [ OK ] 0.42 sec. 2026-03-19 05:45:35 01700_system_zookeeper_path_in: [ OK ] 0.42 sec. 2026-03-19 05:45:35 00937_ipv4_cidr_range: [ OK ] 0.32 sec. 2026-03-19 05:45:36 00503_cast_const_nullable: [ OK ] 0.37 sec. 2026-03-19 05:45:36 03224_json_merges_new_type_in_shared_data: [ OK ] 0.42 sec. 2026-03-19 05:45:36 02122_parallel_formatting_TSV: [ OK ] 2.02 sec. 2026-03-19 05:45:36 00996_neighbor: [ OK ] 0.52 sec. 2026-03-19 05:45:36 02119_sumcount: [ OK ] 0.47 sec. 2026-03-19 05:45:36 00417_kill_query: [ OK ] 3.68 sec. 2026-03-19 05:45:37 01280_unicode_whitespaces_lexer: [ OK ] 0.27 sec. 2026-03-19 05:45:37 02723_jit_aggregation_bug_48120: [ OK ] 0.47 sec. 2026-03-19 05:45:37 01621_bar_nan_arguments: [ OK ] 0.42 sec. 2026-03-19 05:45:37 02813_float_parsing: [ OK ] 0.32 sec. 2026-03-19 05:45:37 01945_system_warnings: [ OK ] 2.12 sec. 2026-03-19 05:45:37 02495_concat_with_separator: [ OK ] 0.52 sec. 2026-03-19 05:45:37 01379_with_fill_several_columns: [ OK ] 0.27 sec. 2026-03-19 05:45:37 02997_projections_formatting: [ OK ] 0.27 sec. 2026-03-19 05:45:37 02319_dict_get_check_arguments_size: [ OK ] 0.52 sec. 2026-03-19 05:45:37 01938_joins_identifiers: [ OK ] 0.32 sec. 2026-03-19 05:45:38 01768_extended_range: [ OK ] 0.27 sec. 2026-03-19 05:45:38 02962_parallel_window_functions_different_partitioning: [ OK ] 0.32 sec. 2026-03-19 05:45:38 00794_materialized_view_with_column_defaults: [ OK ] 0.37 sec. 2026-03-19 05:45:38 01034_prewhere_max_parallel_replicas_distributed: [ OK ] 0.37 sec. 2026-03-19 05:45:38 02974_backup_query_format_null: [ OK ] 1.67 sec. 2026-03-19 05:45:38 01646_fix_window_funnel_inconistency: [ OK ] 0.42 sec. 2026-03-19 05:45:38 02335_column_ttl_expired_column_optimization: [ OK ] 0.87 sec. 2026-03-19 05:45:38 03016_analyzer_groupby_fuzz_59796: [ OK ] 0.32 sec. 2026-03-19 05:45:39 01047_no_alias_columns_with_table_aliases: [ OK ] 0.37 sec. 2026-03-19 05:45:39 01049_window_view_window_functions: [ OK ] 0.57 sec. 2026-03-19 05:45:39 02381_join_dup_columns_in_plan: [ OK ] 0.43 sec. 2026-03-19 05:45:39 01451_detach_drop_part: [ OK ] 0.37 sec. 2026-03-19 05:45:39 00098_k_union_all: [ OK ] 0.32 sec. 2026-03-19 05:45:39 01719_join_timezone: [ OK ] 0.32 sec. 2026-03-19 05:45:39 01081_demangle: [ OK ] 0.27 sec. 2026-03-19 05:45:40 02584_compressor_codecs: [ OK ] 1.02 sec. 2026-03-19 05:45:40 01441_array_combinator: [ OK ] 0.27 sec. 2026-03-19 05:45:40 01780_range_msan: [ OK ] 0.42 sec. 2026-03-19 05:45:40 02501_analyzer_expired_context_crash_fix: [ OK ] 0.37 sec. 2026-03-19 05:45:40 02724_mutliple_storage_join: [ OK ] 0.42 sec. 2026-03-19 05:45:41 01012_select_limit_x_0: [ OK ] 0.27 sec. 2026-03-19 05:45:41 02429_combinators_in_array_reduce: [ OK ] 0.27 sec. 2026-03-19 05:45:41 01691_parser_data_type_exponential: [ OK ] 3.13 sec. 2026-03-19 05:45:41 01047_simple_aggregate_sizes_of_columns_bug: [ OK ] 1.37 sec. 2026-03-19 05:45:41 02946_literal_alias_misclassification: [ OK ] 0.37 sec. 2026-03-19 05:45:41 01463_resample_overflow: [ OK ] 0.32 sec. 2026-03-19 05:45:41 01956_skip_unavailable_shards_excessive_attempts: [ OK ] 1.32 sec. 2026-03-19 05:45:42 02915_analyzer_fuzz_2: [ OK ] 0.32 sec. 2026-03-19 05:45:42 01303_polygons_equals: [ OK ] 0.32 sec. 2026-03-19 05:45:42 01651_lc_insert_tiny_log_2: [ OK ] 3.73 sec. 2026-03-19 05:45:42 00464_array_element_out_of_range: [ OK ] 0.32 sec. 2026-03-19 05:45:42 00593_union_all_assert_columns_removed: [ OK ] 0.37 sec. 2026-03-19 05:45:42 02943_variant_element: [ OK ] 0.37 sec. 2026-03-19 05:45:42 00411_long_accurate_number_comparison_int2: [ OK ] 10.04 sec. 2026-03-19 05:45:42 00311_array_primary_key: [ OK ] 0.37 sec. 2026-03-19 05:45:43 03202_dynamic_null_map_subcolumn: [ OK ] 1.22 sec. 2026-03-19 05:45:43 00082_append_trailing_char_if_absent: [ OK ] 0.32 sec. 2026-03-19 05:45:43 01658_values_ubsan: [ OK ] 0.27 sec. 2026-03-19 05:45:43 02206_clickhouse_local_use_database: [ OK ] 0.77 sec. 2026-03-19 05:45:43 02811_primary_key_in_columns: [ OK ] 0.52 sec. 2026-03-19 05:45:43 03226_alter_update_dynamic_json_not_supported: [ OK ] 0.32 sec. 2026-03-19 05:45:43 02970_visible_width_behavior: [ OK ] 0.32 sec. 2026-03-19 05:45:43 02368_analyzer_table_functions: [ OK ] 0.27 sec. 2026-03-19 05:45:43 02041_openssl_hash_functions_test: [ OK ] 0.32 sec. 2026-03-19 05:45:43 02353_translate: [ OK ] 0.47 sec. 2026-03-19 05:45:43 03043_group_array_result_is_expected: [ OK ] 0.42 sec. 2026-03-19 05:45:43 00753_distributed_system_columns_and_system_tables: [ OK ] 0.32 sec. 2026-03-19 05:45:43 00931_low_cardinality_read_with_empty_array: [ OK ] 0.42 sec. 2026-03-19 05:45:43 01071_prohibition_secondary_index_with_old_format_merge_tree: [ OK ] 0.37 sec. 2026-03-19 05:45:44 03203_variant_convert_field_to_type_bug: [ OK ] 0.32 sec. 2026-03-19 05:45:44 01272_offset_without_limit: [ OK ] 0.42 sec. 2026-03-19 05:45:44 02861_interpolate_alias_precedence: [ OK ] 0.32 sec. 2026-03-19 05:45:44 02900_clickhouse_local_drop_current_database: [ OK ] 0.72 sec. 2026-03-19 05:45:44 03031_clickhouse_local_input: [ OK ] 1.17 sec. 2026-03-19 05:45:44 02793_implicit_pretty_format_settings: [ OK ] 0.82 sec. 2026-03-19 05:45:45 00974_fix_join_on: [ OK ] 0.47 sec. 2026-03-19 05:45:45 02835_fuzz_remove_redundant_sorting: [ OK ] 0.37 sec. 2026-03-19 05:45:45 02181_format_describe_query: [ OK ] 0.57 sec. 2026-03-19 05:45:45 01518_nullable_aggregate_states1: [ OK ] 0.47 sec. 2026-03-19 05:45:45 02541_empty_function_support_ip: [ OK ] 0.32 sec. 2026-03-19 05:45:46 02125_lz4_compression_bug_TSKV: [ OK ] 4.88 sec. 2026-03-19 05:45:46 01496_signedness_conversion_monotonicity: [ OK ] 0.27 sec. 2026-03-19 05:45:46 00974_primary_key_for_lowCardinality: [ OK ] 2.58 sec. 2026-03-19 05:45:47 03013_position_const_start_pos: [ OK ] 0.27 sec. 2026-03-19 05:45:47 00473_output_format_json_quote_denormals: [ OK ] 1.97 sec. 2026-03-19 05:45:47 01945_show_debug_warning: [ OK ] 2.52 sec. 2026-03-19 05:45:47 01865_aggregator_overflow_row: [ OK ] 0.32 sec. 2026-03-19 05:45:47 01592_length_map: [ OK ] 0.32 sec. 2026-03-19 05:45:47 02250_lots_of_columns_in_csv_with_names: [ OK ] 2.02 sec. 2026-03-19 05:45:47 00101_materialized_views_and_insert_without_explicit_database: [ OK ] 0.57 sec. 2026-03-19 05:45:47 02940_json_array_of_unnamed_tuples_inference: [ OK ] 0.27 sec. 2026-03-19 05:45:48 03246_json_simd_rapid_parsers: [ OK ] 1.22 sec. 2026-03-19 05:45:48 01290_max_execution_speed_distributed: [ OK ] 2.58 sec. 2026-03-19 05:45:48 01699_timezoneOffset: [ OK ] 0.52 sec. 2026-03-19 05:45:48 02899_indexing_by_space_filling_curves: [ OK ] 0.57 sec. 2026-03-19 05:45:48 00459_group_array_insert_at: [ OK ] 0.37 sec. 2026-03-19 05:45:48 01143_trivial_count_with_join: [ OK ] 0.42 sec. 2026-03-19 05:45:48 00800_low_cardinality_merge_join: [ OK ] 0.97 sec. 2026-03-19 05:45:48 00601_kill_running_query: [ OK ] 0.62 sec. 2026-03-19 05:45:48 02416_keeper_map: [ OK ] 0.97 sec. 2026-03-19 05:45:49 01710_projections_group_by_no_key: [ OK ] 0.37 sec. 2026-03-19 05:45:49 00966_invalid_json_must_not_parse: [ OK ] 0.37 sec. 2026-03-19 05:45:49 01352_generate_random_overflow: [ OK ] 0.32 sec. 2026-03-19 05:45:49 01324_settings_documentation: [ OK ] 0.37 sec. 2026-03-19 05:45:49 00996_limit_with_ties: [ OK ] 0.47 sec. 2026-03-19 05:45:49 02421_truncate_isolation_with_mutations: [ OK ] 19.02 sec. 2026-03-19 05:45:49 02012_compress_lz4: [ OK ] 1.07 sec. 2026-03-19 05:45:49 03004_force_null_for_omitted: [ OK ] 0.62 sec. 2026-03-19 05:45:49 02292_nested_not_flattened_detach: [ OK ] 0.27 sec. 2026-03-19 05:45:49 01915_merge_prewhere_virtual_column_rand_chao_wang: [ OK ] 0.32 sec. 2026-03-19 05:45:49 00732_base64_functions: [ OK ] 0.32 sec. 2026-03-19 05:45:49 03200_memory_engine_alter_dynamic: [ OK ] 0.37 sec. 2026-03-19 05:45:50 03167_base64_url_functions: [ OK ] 0.37 sec. 2026-03-19 05:45:50 02932_group_by_null_fuzzer: [ OK ] 0.37 sec. 2026-03-19 05:45:50 02921_bit_hamming_distance_big_int: [ OK ] 0.32 sec. 2026-03-19 05:45:50 01519_topK_distributed_parametrized: [ OK ] 0.42 sec. 2026-03-19 05:45:50 02514_bad_index_granularity: [ OK ] 0.32 sec. 2026-03-19 05:45:50 03060_analyzer_regular_view_alias: [ OK ] 0.27 sec. 2026-03-19 05:45:50 01064_pm_all_join_const_and_nullable: [ OK ] 0.62 sec. 2026-03-19 05:45:50 01512_create_replicate_merge_tree_one_arg: [ OK ] 0.27 sec. 2026-03-19 05:45:50 03208_numbers_total_rows_approx: [ OK ] 0.27 sec. 2026-03-19 05:45:51 01818_move_partition_simple: [ OK ] 0.42 sec. 2026-03-19 05:45:51 01772_to_start_of_hour_align: [ OK ] 0.32 sec. 2026-03-19 05:45:51 01018_ddl_dictionaries_select: [ OK ] 0.57 sec. 2026-03-19 05:45:51 01014_format_custom_separated: [ OK ] 2.78 sec. 2026-03-19 05:45:51 02995_index_9: [ SKIPPED ] 0.00 sec. 2026-03-19 05:45:51 Reason: not running for current build 2026-03-19 05:45:51 00980_zookeeper_merge_tree_alter_settings: [ OK ] 0.77 sec. 2026-03-19 05:45:51 02311_hashed_array_dictionary_hierarchical_functions: [ OK ] 0.42 sec. 2026-03-19 05:45:52 02124_insert_deduplication_token: [ OK ] 0.42 sec. 2026-03-19 05:45:52 02949_ttl_group_by_bug: [ OK ] 0.42 sec. 2026-03-19 05:45:52 01034_unknown_qualified_column_in_join: [ OK ] 0.37 sec. 2026-03-19 05:45:52 01116_cross_count_asterisks: [ OK ] 0.32 sec. 2026-03-19 05:45:52 02920_rename_column_of_skip_indices: [ OK ] 0.37 sec. 2026-03-19 05:45:52 01611_string_to_low_cardinality_key_alter: [ OK ] 0.42 sec. 2026-03-19 05:45:52 01095_tpch_like_smoke: [ OK ] 0.97 sec. 2026-03-19 05:45:52 02811_invalid_embedded_rocksdb_create: [ OK ] 0.37 sec. 2026-03-19 05:45:54 02811_csv_input_field_type_mismatch: [ OK ] 1.82 sec. 2026-03-19 05:45:54 03020_long_values_pretty_are_not_cut_if_single: [ OK ] 2.23 sec. 2026-03-19 05:45:55 03036_schema_inference_cache_s3_archives: [ OK ] 0.32 sec. 2026-03-19 05:45:55 00917_multiple_joins_denny_crane: [ OK ] 0.32 sec. 2026-03-19 05:45:55 01526_param_uuid: [ OK ] 0.87 sec. 2026-03-19 05:45:55 02188_table_function_format: [ OK ] 0.27 sec. 2026-03-19 05:45:55 00564_versioned_collapsing_merge_tree: [ OK ] 5.78 sec. 2026-03-19 05:45:56 00607_index_in_in: [ OK ] 0.32 sec. 2026-03-19 05:45:56 03130_analyzer_self_join_group_by: [ OK ] 0.42 sec. 2026-03-19 05:45:56 01921_with_fill_with_totals: [ OK ] 0.27 sec. 2026-03-19 05:45:56 02124_insert_deduplication_token_replica: [ OK ] 0.52 sec. 2026-03-19 05:45:56 02561_temporary_table_grants: [ OK ] 4.49 sec. 2026-03-19 05:45:57 00825_protobuf_format_skipped_column_in_nested: [ OK ] 1.92 sec. 2026-03-19 05:45:57 02133_distributed_queries_formatting: [ OK ] 0.32 sec. 2026-03-19 05:45:58 02313_test_fpc_codec: [ OK ] 0.52 sec. 2026-03-19 05:45:58 01923_different_expression_name_alias: [ OK ] 0.32 sec. 2026-03-19 05:45:58 02118_deserialize_whole_text: [ OK ] 5.73 sec. 2026-03-19 05:45:58 00477_parsing_data_types: [ OK ] 0.22 sec. 2026-03-19 05:45:58 00205_emptyscalar_subquery_type_mismatch_bug: [ OK ] 0.32 sec. 2026-03-19 05:45:59 01418_index_analysis_bug: [ OK ] 0.42 sec. 2026-03-19 05:45:59 00199_ternary_operator_type_check: [ OK ] 0.67 sec. 2026-03-19 05:45:59 00125_array_element_of_array_of_tuple: [ OK ] 0.27 sec. 2026-03-19 05:45:59 02167_format_from_file_extension: [ OK ] 11.80 sec. 2026-03-19 05:45:59 01576_alter_low_cardinality_and_select: [ OK ] 3.38 sec. 2026-03-19 05:45:59 03095_msan_uuid_string_to_num: [ OK ] 0.37 sec. 2026-03-19 05:46:00 02907_fromDaysSinceYearZero: [ OK ] 0.62 sec. 2026-03-19 05:46:00 02311_range_hashed_dictionary_range_cast: [ OK ] 0.32 sec. 2026-03-19 05:46:00 01076_predicate_optimizer_with_view: [ OK ] 0.47 sec. 2026-03-19 05:46:00 00324_hashing_enums: [ OK ] 0.32 sec. 2026-03-19 05:46:00 02699_polygons_sym_difference_rollup: [ OK ] 0.32 sec. 2026-03-19 05:46:00 03036_reading_s3_archives: [ OK ] 0.82 sec. 2026-03-19 05:46:00 00024_unused_array_join_in_subquery: [ OK ] 0.27 sec. 2026-03-19 05:46:01 02377_modify_column_from_lc: [ OK ] 0.42 sec. 2026-03-19 05:46:01 02898_parallel_replicas_custom_key_final: [ OK ] 0.32 sec. 2026-03-19 05:46:01 03210_optimize_rewrite_aggregate_function_with_if_return_type_bug: [ OK ] 0.37 sec. 2026-03-19 05:46:01 01459_default_value_of_argument_type_nullptr_dereference: [ OK ] 0.27 sec. 2026-03-19 05:46:01 00421_storage_merge__table_index: [ OK ] 12.00 sec. 2026-03-19 05:46:01 01518_select_in_null: [ OK ] 0.97 sec. 2026-03-19 05:46:02 01388_multi_if_optimization: [ OK ] 0.27 sec. 2026-03-19 05:46:02 01086_window_view_cleanup: [ OK ] 5.18 sec. 2026-03-19 05:46:02 00195_shard_union_all_and_global_in: [ OK ] 0.37 sec. 2026-03-19 05:46:02 02554_format_json_columns_for_empty: [ OK ] 0.27 sec. 2026-03-19 05:46:02 00192_least_greatest: [ OK ] 0.37 sec. 2026-03-19 05:46:02 02864_statistics_delayed_materialization_in_merge: [ OK ] 0.37 sec. 2026-03-19 05:46:02 01079_order_by_pk: [ OK ] 5.63 sec. 2026-03-19 05:46:02 01710_projection_with_ast_rewrite_settings: [ OK ] 0.42 sec. 2026-03-19 05:46:03 01040_distributed_background_insert_batch_inserts: [ OK ] 0.47 sec. 2026-03-19 05:46:03 01848_partition_value_column: [ OK ] 0.37 sec. 2026-03-19 05:46:03 00950_default_prewhere: [ OK ] 0.37 sec. 2026-03-19 05:46:03 02126_url_auth: [ OK ] 1.12 sec. 2026-03-19 05:46:03 01561_aggregate_functions_of_key_with_join: [ OK ] 0.32 sec. 2026-03-19 05:46:03 01097_one_more_range_reader_test_wide_part: [ OK ] 0.32 sec. 2026-03-19 05:46:03 02718_parquet_metadata_format: [ OK ] 1.57 sec. 2026-03-19 05:46:03 02575_merge_prewhere_default_expression: [ OK ] 0.47 sec. 2026-03-19 05:46:04 00647_histogram: [ OK ] 0.32 sec. 2026-03-19 05:46:04 02900_issue_55858: [ OK ] 0.37 sec. 2026-03-19 05:46:04 00578_merge_table_sampling: [ OK ] 0.37 sec. 2026-03-19 05:46:04 01804_uniq_up_to_ubsan: [ OK ] 0.27 sec. 2026-03-19 05:46:04 03010_sum_to_to_count_if_nullable: [ OK ] 0.42 sec. 2026-03-19 05:46:05 00409_shard_limit_by: [ OK ] 0.47 sec. 2026-03-19 05:46:05 02833_local_with_dialect: [ OK ] 0.82 sec. 2026-03-19 05:46:05 03033_create_as_copies_comment: [ OK ] 0.27 sec. 2026-03-19 05:46:05 02426_pod_array_overflow_2: [ OK ] 0.32 sec. 2026-03-19 05:46:05 01633_limit_fuzz: [ OK ] 0.32 sec. 2026-03-19 05:46:05 02165_h3_edge_length_km: [ OK ] 0.47 sec. 2026-03-19 05:46:06 01821_join_table_mutation: [ OK ] 0.37 sec. 2026-03-19 05:46:06 00564_temporary_table_management: [ OK ] 0.22 sec. 2026-03-19 05:46:06 01017_in_unconvertible_complex_type: [ OK ] 0.37 sec. 2026-03-19 05:46:06 02408_to_fixed_string_short_circuit: [ OK ] 0.32 sec. 2026-03-19 05:46:06 01880_materialized_view_to_table_type_check: [ OK ] 0.42 sec. 2026-03-19 05:46:07 03095_merge_and_buffer_tables: [ OK ] 0.42 sec. 2026-03-19 05:46:07 00517_date_parsing: [ OK ] 0.42 sec. 2026-03-19 05:46:07 02751_text_formats_bad_nullable_parsing: [ OK ] 2.78 sec. 2026-03-19 05:46:07 01014_count_of_merges_metrics: [ OK ] 0.32 sec. 2026-03-19 05:46:07 01881_to_week_monotonic_fix: [ OK ] 0.42 sec. 2026-03-19 05:46:07 00700_decimal_null: [ OK ] 0.47 sec. 2026-03-19 05:46:08 01882_check_max_parts_to_merge_at_once: [ OK ] 0.82 sec. 2026-03-19 05:46:08 03165_order_by_duplicate: [ OK ] 0.32 sec. 2026-03-19 05:46:08 01940_custom_tld_sharding_key: [ OK ] 0.32 sec. 2026-03-19 05:46:08 02842_suggest_http_page_in_error_message: [ OK ] 0.67 sec. 2026-03-19 05:46:08 01428_hash_set_nan_key: [ OK ] 0.27 sec. 2026-03-19 05:46:08 00834_date_datetime_cmp: [ OK ] 0.37 sec. 2026-03-19 05:46:09 02963_remote_read_small_buffer_size_bug: [ OK ] 5.38 sec. 2026-03-19 05:46:09 03207_json_read_subcolumns_2_memory: [ SKIPPED ] 0.00 sec. 2026-03-19 05:46:09 Reason: not running for current build 2026-03-19 05:46:09 01771_datetime64_no_time_part: [ OK ] 0.27 sec. 2026-03-19 05:46:09 03049_unknown_identifier_materialized_column: [ OK ] 0.32 sec. 2026-03-19 05:46:09 03222_json_squashing: [ OK ] 1.02 sec. 2026-03-19 05:46:09 01664_array_slice_ubsan: [ OK ] 0.27 sec. 2026-03-19 05:46:09 02151_replace_regexp_all_empty_match_alternative: [ OK ] 0.32 sec. 2026-03-19 05:46:09 01890_jit_aggregation_function_sum_long: [ OK ] 1.22 sec. 2026-03-19 05:46:09 02029_quantile_sanitizer: [ OK ] 0.27 sec. 2026-03-19 05:46:10 02991_count_rewrite_analyzer: [ OK ] 0.27 sec. 2026-03-19 05:46:10 00453_top_k: [ OK ] 0.27 sec. 2026-03-19 05:46:10 00930_arrayIntersect: [ OK ] 0.42 sec. 2026-03-19 05:46:10 01715_background_checker_blather_zookeeper_long: [ OK ] 10.45 sec. 2026-03-19 05:46:11 03024_total_rows_approx_is_set_for_system_zeros_and_generate_random: [ OK ] 0.32 sec. 2026-03-19 05:46:11 03038_nested_dynamic_merges_small: [ OK ] 1.47 sec. 2026-03-19 05:46:11 02911_system_symbols: [ OK ] 0.62 sec. 2026-03-19 05:46:11 00988_parallel_parts_removal: [ OK ] 1.72 sec. 2026-03-19 05:46:11 01268_mv_scalars: [ OK ] 0.57 sec. 2026-03-19 05:46:11 03215_validate_type_in_alter_add_modify_column: [ OK ] 0.57 sec. 2026-03-19 05:46:11 02981_translate_fixedstring: [ OK ] 0.32 sec. 2026-03-19 05:46:12 00360_to_date_from_string_with_datetime: [ OK ] 0.27 sec. 2026-03-19 05:46:12 01010_pmj_on_disk: [ OK ] 0.42 sec. 2026-03-19 05:46:12 02260_alter_compact_part_drop_nested_column: [ OK ] 0.47 sec. 2026-03-19 05:46:12 01797_StripeLog_rwlock_ub: [ OK ] 0.27 sec. 2026-03-19 05:46:12 01385_not_function: [ OK ] 0.32 sec. 2026-03-19 05:46:12 01958_partial_hour_timezone: [ OK ] 0.37 sec. 2026-03-19 05:46:12 02461_welch_t_test_fuzz: [ OK ] 0.27 sec. 2026-03-19 05:46:12 02554_log_faminy_support_storage_policy: [ OK ] 0.42 sec. 2026-03-19 05:46:13 00151_tuple_with_array: [ OK ] 0.27 sec. 2026-03-19 05:46:13 02242_case_insensitive_column_matching: [ OK ] 4.18 sec. 2026-03-19 05:46:13 03447_grouping_sets_analyzer_const_columns: [ OK ] 0.32 sec. 2026-03-19 05:46:13 01527_materialized_view_stack_overflow: [ OK ] 1.17 sec. 2026-03-19 05:46:14 03033_dist_settings.optimize_skip_unused_shards_rewrite_in_composite_sharding_key: [ OK ] 0.48 sec. 2026-03-19 05:46:14 01940_point_in_polygon_ubsan: [ OK ] 0.27 sec. 2026-03-19 05:46:14 02875_parallel_replicas_cluster_all_replicas: [ OK ] 0.83 sec. 2026-03-19 05:46:14 01558_ttest_scipy: [ OK ] 1.72 sec. 2026-03-19 05:46:14 00872_t64_bit_codec: [ OK ] 1.07 sec. 2026-03-19 05:46:15 03144_alter_column_and_read: [ OK ] 0.37 sec. 2026-03-19 05:46:15 02864_statistics_predicates: [ OK ] 1.32 sec. 2026-03-19 05:46:16 02122_parallel_formatting_Pretty: [ OK ] 4.68 sec. 2026-03-19 05:46:16 02122_parallel_formatting_JSONCompactEachRowWithNamesAndTypes: [ OK ] 2.08 sec. 2026-03-19 05:46:16 00431_if_nulls: [ OK ] 0.97 sec. 2026-03-19 05:46:16 03215_parallel_replicas_crash_after_refactoring: [ OK ] 0.33 sec. 2026-03-19 05:46:17 02380_insert_mv_race: [ OK ] 2.17 sec. 2026-03-19 05:46:17 00936_substring_utf8_non_const: [ OK ] 1.67 sec. 2026-03-19 05:46:17 01674_clickhouse_client_query_param_cte: [ OK ] 0.87 sec. 2026-03-19 05:46:17 02972_parallel_replicas_cte: [ OK ] 0.62 sec. 2026-03-19 05:46:17 00621_regression_for_in_operator: [ OK ] 0.42 sec. 2026-03-19 05:46:17 03142_window_function_limit_by: [ OK ] 0.32 sec. 2026-03-19 05:46:17 01655_window_functions_bug: [ OK ] 0.37 sec. 2026-03-19 05:46:18 03273_dynamic_pretty_json_serialization: [ OK ] 0.27 sec. 2026-03-19 05:46:18 02013_bloom_filter_hasAll: [ OK ] 0.52 sec. 2026-03-19 05:46:18 01384_bloom_filter_bad_arguments: [ OK ] 0.42 sec. 2026-03-19 05:46:18 00482_subqueries_and_aliases: [ OK ] 0.42 sec. 2026-03-19 05:46:19 02561_sorting_constants_and_distinct_crash: [ OK ] 3.03 sec. 2026-03-19 05:46:19 02845_table_function_hdfs_filter_by_virtual_columns: [ OK ] 2.48 sec. 2026-03-19 05:46:19 01576_if_null_external_aggregation: [ OK ] 1.27 sec. 2026-03-19 05:46:19 01825_type_json_missed_values: [ OK ] 0.37 sec. 2026-03-19 05:46:20 01451_wrong_error_long_query: [ OK ] 0.57 sec. 2026-03-19 05:46:20 02705_projection_and_ast_optimizations_bug: [ OK ] 0.27 sec. 2026-03-19 05:46:20 01614_with_fill_with_limit: [ OK ] 0.27 sec. 2026-03-19 05:46:20 02136_scalar_progress: [ OK ] 0.62 sec. 2026-03-19 05:46:20 01825_new_type_json_7: [ OK ] 1.92 sec. 2026-03-19 05:46:20 00534_functions_bad_arguments12: [ SKIPPED ] 0.00 sec. 2026-03-19 05:46:20 Reason: not running for current build 2026-03-19 05:46:20 00118_storage_join: [ OK ] 0.32 sec. 2026-03-19 05:46:21 01072_optimize_skip_unused_shards_const_expr_eval: [ OK ] 0.62 sec. 2026-03-19 05:46:21 01001_enums_in_in_section: [ OK ] 0.32 sec. 2026-03-19 05:46:21 03207_json_read_subcolumns_1_memory: [ OK ] 1.12 sec. 2026-03-19 05:46:21 02565_analyzer_limit_settings: [ OK ] 0.37 sec. 2026-03-19 05:46:21 02471_wrong_date_monotonicity: [ OK ] 0.32 sec. 2026-03-19 05:46:21 02503_join_switch_alias_fuzz: [ OK ] 0.27 sec. 2026-03-19 05:46:21 02680_illegal_type_of_filter_projection: [ OK ] 0.32 sec. 2026-03-19 05:46:22 02030_rocksdb_race_long: [ OK ] 21.13 sec. 2026-03-19 05:46:22 01431_utf8_ubsan: [ OK ] 0.27 sec. 2026-03-19 05:46:22 01198_client_quota_key: [ OK ] 0.97 sec. 2026-03-19 05:46:22 01323_add_scalars_in_time: [ OK ] 0.42 sec. 2026-03-19 05:46:23 02516_projections_with_rollup: [ OK ] 1.77 sec. 2026-03-19 05:46:23 02345_analyzer_subqueries: [ OK ] 0.42 sec. 2026-03-19 05:46:23 02591_bson_long_tuple: [ OK ] 0.27 sec. 2026-03-19 05:46:23 01020_function_char: [ OK ] 0.32 sec. 2026-03-19 05:46:23 02151_client_option_echo: [ OK ] 1.47 sec. 2026-03-19 05:46:23 02552_client_format_settings: [ OK ] 0.32 sec. 2026-03-19 05:46:23 03127_argMin_combinator_state: [ OK ] 0.32 sec. 2026-03-19 05:46:24 03222_datetime64_small_value_const: [ OK ] 0.52 sec. 2026-03-19 05:46:24 03038_nested_dynamic_merges_wide_horizontal: [ OK ] 2.83 sec. 2026-03-19 05:46:24 01825_new_type_json_distributed: [ OK ] 0.37 sec. 2026-03-19 05:46:24 01825_new_type_json_9: [ OK ] 0.37 sec. 2026-03-19 05:46:24 02179_degrees_radians: [ OK ] 0.37 sec. 2026-03-19 05:46:24 00763_create_query_as_table_engine_bug: [ OK ] 0.32 sec. 2026-03-19 05:46:24 01674_unicode_asan: [ OK ] 0.32 sec. 2026-03-19 05:46:24 01477_lc_in_merge_join_left_key: [ OK ] 0.62 sec. 2026-03-19 05:46:24 01353_topk_enum: [ OK ] 0.32 sec. 2026-03-19 05:46:24 01780_column_sparse_filter: [ OK ] 0.42 sec. 2026-03-19 05:46:25 01288_shard_max_network_bandwidth: [ OK ] 2.88 sec. 2026-03-19 05:46:25 00672_arrayDistinct: [ OK ] 0.37 sec. 2026-03-19 05:46:25 01308_row_policy_and_trivial_count_query: [ OK ] 0.32 sec. 2026-03-19 05:46:25 01710_minmax_count_projection_modify_partition_key: [ OK ] 0.37 sec. 2026-03-19 05:46:25 00450_higher_order_and_nullable: [ OK ] 0.32 sec. 2026-03-19 05:46:25 02901_remove_nullable_crash_analyzer: [ OK ] 0.37 sec. 2026-03-19 05:46:25 02733_sparse_columns_reload: [ OK ] 0.37 sec. 2026-03-19 05:46:25 00940_max_parts_in_total: [ OK ] 0.32 sec. 2026-03-19 05:46:25 02881_system_detached_parts_modification_time: [ OK ] 0.37 sec. 2026-03-19 05:46:26 00405_output_format_pretty_color: [ OK ] 0.42 sec. 2026-03-19 05:46:26 02364_window_case: [ OK ] 0.37 sec. 2026-03-19 05:46:26 03006_join_on_inequal_expression_3: [ OK ] 0.57 sec. 2026-03-19 05:46:26 01522_validate_alter_default: [ OK ] 0.27 sec. 2026-03-19 05:46:26 01926_date_date_time_supertype: [ OK ] 0.37 sec. 2026-03-19 05:46:26 02751_multiquery_with_argument: [ OK ] 2.23 sec. 2026-03-19 05:46:26 01182_materialized_view_different_structure: [ OK ] 0.57 sec. 2026-03-19 05:46:26 02178_column_function_insert_from: [ OK ] 0.32 sec. 2026-03-19 05:46:26 01910_view_dictionary_check_refresh: [ OK ] 24.44 sec. 2026-03-19 05:46:27 00490_special_line_separators_and_characters_outside_of_bmp: [ OK ] 0.27 sec. 2026-03-19 05:46:27 03126_column_not_under_group_by: [ OK ] 0.27 sec. 2026-03-19 05:46:27 00258_materializing_tuples: [ OK ] 0.32 sec. 2026-03-19 05:46:27 02701_invalid_having_NOT_AN_AGGREGATE: [ OK ] 0.27 sec. 2026-03-19 05:46:27 02430_initialize_aggregation_with_combinators: [ OK ] 0.32 sec. 2026-03-19 05:46:27 01456_low_cardinality_sorting_bugfix: [ OK ] 0.32 sec. 2026-03-19 05:46:27 02477_invalid_reads: [ OK ] 0.82 sec. 2026-03-19 05:46:27 02922_respect_nulls_Nullable: [ OK ] 0.37 sec. 2026-03-19 05:46:27 03203_multiif_and_where_2_conditions_old_analyzer_bug: [ OK ] 0.37 sec. 2026-03-19 05:46:28 02790_fix_coredump_when_compile_expression: [ OK ] 0.27 sec. 2026-03-19 05:46:28 02735_array_map_array_of_tuples: [ OK ] 0.27 sec. 2026-03-19 05:46:28 01432_parse_date_time_best_effort_timestamp: [ OK ] 0.27 sec. 2026-03-19 05:46:28 02575_map_hashing_msan: [ OK ] 0.32 sec. 2026-03-19 05:46:29 00804_test_custom_compression_codecs: [ OK ] 0.83 sec. 2026-03-19 05:46:29 03148_async_queries_in_query_log_errors: [ OK ] 2.17 sec. 2026-03-19 05:46:29 01065_if_not_finite: [ OK ] 0.37 sec. 2026-03-19 05:46:29 02125_constant_if_condition_and_not_existing_column: [ OK ] 0.37 sec. 2026-03-19 05:46:30 01548_uncomparable_columns_in_keys: [ OK ] 0.32 sec. 2026-03-19 05:46:30 02933_replicated_database_forbid_create_as_select: [ OK ] 3.18 sec. 2026-03-19 05:46:30 00603_system_parts_nonexistent_database: [ OK ] 0.27 sec. 2026-03-19 05:46:30 02477_age: [ OK ] 0.52 sec. 2026-03-19 05:46:30 00596_limit_on_expanded_ast: [ OK ] 0.87 sec. 2026-03-19 05:46:30 01851_s2_to_geo: [ OK ] 0.27 sec. 2026-03-19 05:46:31 00837_minmax_index: [ OK ] 2.58 sec. 2026-03-19 05:46:31 02012_sha512_fixedstring: [ OK ] 0.32 sec. 2026-03-19 05:46:31 01051_aggregate_function_crash: [ OK ] 0.27 sec. 2026-03-19 05:46:31 01338_long_select_and_alter: [ OK ] 13.65 sec. 2026-03-19 05:46:31 02841_group_array_sorted: [ OK ] 0.72 sec. 2026-03-19 05:46:31 02233_optimize_aggregation_in_order_prefix: [ OK ] 0.37 sec. 2026-03-19 05:46:31 00236_replicated_drop_on_non_leader_zookeeper_long: [ OK ] 0.37 sec. 2026-03-19 05:46:32 00954_client_prepared_statements: [ OK ] 4.48 sec. 2026-03-19 05:46:32 03007_column_nullable_uninitialzed_value: [ OK ] 0.27 sec. 2026-03-19 05:46:32 03169_time_virtual_column: [ OK ] 1.67 sec. 2026-03-19 05:46:32 01358_mutation_delete_null_rows: [ OK ] 0.37 sec. 2026-03-19 05:46:32 03207_composite_expressions_lambda_consistent_formatting: [ OK ] 0.37 sec. 2026-03-19 05:46:32 01410_nullable_key_and_index: [ OK ] 0.57 sec. 2026-03-19 05:46:32 01050_group_array_sample: [ OK ] 0.37 sec. 2026-03-19 05:46:32 01051_new_any_join_engine: [ OK ] 0.63 sec. 2026-03-19 05:46:33 01558_enum_as_num_in_tsv_csv_input: [ OK ] 0.37 sec. 2026-03-19 05:46:33 01083_aggregation_memory_efficient_bug: [ OK ] 0.67 sec. 2026-03-19 05:46:33 00268_aliases_without_as_keyword: [ OK ] 0.39 sec. 2026-03-19 05:46:33 03166_optimize_row_order_during_insert: [ OK ] 0.73 sec. 2026-03-19 05:46:35 01308_orc_output_format_arrays: [ OK ] 2.18 sec. 2026-03-19 05:46:35 03261_test_merge_parquet_bloom_filter_minmax_stats: [ OK ] 1.12 sec. 2026-03-19 05:46:35 00300_csv: [ OK ] 0.27 sec. 2026-03-19 05:46:35 02415_all_new_functions_must_be_documented: [ OK ] 0.27 sec. 2026-03-19 05:46:35 02995_index_10: [ SKIPPED ] 0.00 sec. 2026-03-19 05:46:35 Reason: not running for current build 2026-03-19 05:46:35 02024_compression_in_query: [ OK ] 3.68 sec. 2026-03-19 05:46:35 01890_state_of_state: [ OK ] 0.47 sec. 2026-03-19 05:46:36 00715_bounding_ratio_merge_empty: [ OK ] 0.42 sec. 2026-03-19 05:46:36 02844_table_function_url_filter_by_virtual_columns: [ OK ] 0.87 sec. 2026-03-19 05:46:36 01784_parallel_formatting_memory: [ OK ] 0.37 sec. 2026-03-19 05:46:36 03215_grant_current_grants: [ OK ] 2.73 sec. 2026-03-19 05:46:36 02597_projection_materialize_and_replication: [ OK ] 1.37 sec. 2026-03-19 05:46:36 01051_window_view_parser_hop: [ OK ] 0.52 sec. 2026-03-19 05:46:36 02813_func_today_and_alias: [ OK ] 0.32 sec. 2026-03-19 05:46:37 01100_split_by_string: [ OK ] 0.32 sec. 2026-03-19 05:46:37 02572_query_views_log_background_thread: [ OK ] 12.06 sec. 2026-03-19 05:46:37 01509_check_many_parallel_quorum_inserts_long: [ OK ] 6.54 sec. 2026-03-19 05:46:37 01019_array_fill: [ OK ] 0.32 sec. 2026-03-19 05:46:37 02515_and_or_if_multiif_not_return_lc: [ OK ] 0.27 sec. 2026-03-19 05:46:37 02497_source_part_is_intact_when_mutation: [ OK ] 0.37 sec. 2026-03-19 05:46:37 00876_wrong_arraj_join_column: [ OK ] 0.27 sec. 2026-03-19 05:46:37 01780_column_sparse_distinct: [ OK ] 0.27 sec. 2026-03-19 05:46:37 01354_tuple_low_cardinality_array_mapped_bug: [ OK ] 0.27 sec. 2026-03-19 05:46:37 01427_pk_and_expression_with_different_type: [ OK ] 0.27 sec. 2026-03-19 05:46:37 02020_cast_integer_overflow: [ OK ] 0.27 sec. 2026-03-19 05:46:38 01508_explain_header: [ OK ] 0.27 sec. 2026-03-19 05:46:38 02343_analyzer_column_transformers_strict: [ OK ] 0.32 sec. 2026-03-19 05:46:38 02933_ephemeral_mv: [ OK ] 0.32 sec. 2026-03-19 05:46:38 01662_date_ubsan: [ OK ] 0.52 sec. 2026-03-19 05:46:39 02373_datetime64_monotonicity: [ OK ] 2.47 sec. 2026-03-19 05:46:39 01825_type_json_13: [ OK ] 2.23 sec. 2026-03-19 05:46:39 02922_server_exit_code: [ OK ] 0.77 sec. 2026-03-19 05:46:39 00152_totals_in_subquery: [ OK ] 0.37 sec. 2026-03-19 05:46:40 03013_group_by_use_nulls_with_materialize_and_analyzer: [ OK ] 0.37 sec. 2026-03-19 05:46:40 03172_http_content_encoding: [ OK ] 2.28 sec. 2026-03-19 05:46:40 02813_any_value: [ OK ] 0.32 sec. 2026-03-19 05:46:40 02358_file_default_value: [ OK ] 1.12 sec. 2026-03-19 05:46:40 01085_datetime_arithmetic_preserve_timezone: [ OK ] 0.27 sec. 2026-03-19 05:46:40 00552_logical_functions_simple: [ OK ] 0.32 sec. 2026-03-19 05:46:40 03085_analyzer_alias_column_group_by: [ OK ] 0.27 sec. 2026-03-19 05:46:40 03150_url_hash_non_constant_level: [ OK ] 0.32 sec. 2026-03-19 05:46:40 03041_select_with_query_result: [ OK ] 0.32 sec. 2026-03-19 05:46:40 01323_redundant_functions_in_order_by: [ OK ] 0.52 sec. 2026-03-19 05:46:41 00723_remerge_sort: [ OK ] 0.42 sec. 2026-03-19 05:46:41 02963_test_flexible_disk_configuration: [ OK ] 0.72 sec. 2026-03-19 05:46:41 02876_yyyymmddhhmmsstodatetime: [ OK ] 0.82 sec. 2026-03-19 05:46:41 02915_analyzer_fuzz_6: [ OK ] 0.32 sec. 2026-03-19 05:46:41 01079_bit_operations_using_bitset: [ OK ] 0.32 sec. 2026-03-19 05:46:42 02160_h3_hex_area_Km2: [ OK ] 0.32 sec. 2026-03-19 05:46:42 03006_mv_deduplication_throw_if_async_insert: [ OK ] 0.67 sec. 2026-03-19 05:46:42 00952_basic_constraints: [ OK ] 4.53 sec. 2026-03-19 05:46:42 00308_write_buffer_valid_utf8: [ OK ] 0.27 sec. 2026-03-19 05:46:42 00712_prewhere_with_alias_bug_2: [ OK ] 0.37 sec. 2026-03-19 05:46:42 02002_system_table_with_tuple: [ OK ] 0.88 sec. 2026-03-19 05:46:43 01380_nullable_state: [ OK ] 0.52 sec. 2026-03-19 05:46:43 02916_replication_protocol_wait_for_part: [ OK ] 10.70 sec. 2026-03-19 05:46:43 03215_parsing_archive_name_s3: [ OK ] 0.47 sec. 2026-03-19 05:46:43 02735_system_zookeeper_connection: [ OK ] 0.32 sec. 2026-03-19 05:46:43 01284_escape_sequences_php_mysql_style: [ OK ] 0.32 sec. 2026-03-19 05:46:44 02245_s3_schema_desc: [ OK ] 0.52 sec. 2026-03-19 05:46:44 01424_parse_date_time_bad_date: [ OK ] 0.42 sec. 2026-03-19 05:46:44 03023_remove_unused_column_distinct: [ OK ] 0.37 sec. 2026-03-19 05:46:44 01419_merge_tree_settings_sanity_check: [ OK ] 0.52 sec. 2026-03-19 05:46:44 01680_predicate_pushdown_union_distinct_subquery: [ OK ] 0.27 sec. 2026-03-19 05:46:45 02884_parquet_new_encodings: [ OK ] 0.77 sec. 2026-03-19 05:46:45 02691_multiple_joins_backtick_identifiers: [ OK ] 0.37 sec. 2026-03-19 05:46:45 01293_client_interactive_vertical_singleline: [ OK ] 0.83 sec. 2026-03-19 05:46:45 00149_function_url_hash: [ OK ] 0.32 sec. 2026-03-19 05:46:45 03155_datasketches_ubsan: [ OK ] 0.22 sec. 2026-03-19 05:46:46 01330_array_join_in_higher_order_function: [ OK ] 0.22 sec. 2026-03-19 05:46:46 00609_distributed_with_case_when_then: [ OK ] 0.42 sec. 2026-03-19 05:46:46 02316_values_table_func_bug: [ OK ] 0.32 sec. 2026-03-19 05:46:46 03228_dynamic_serializations_uninitialized_value: [ OK ] 0.42 sec. 2026-03-19 05:46:46 02458_insert_select_progress_tcp: [ OK ] 3.13 sec. 2026-03-19 05:46:47 03168_query_log_privileges_not_empty: [ OK ] 4.23 sec. 2026-03-19 05:46:47 01922_array_join_with_index: [ OK ] 0.32 sec. 2026-03-19 05:46:47 00555_right_join_excessive_rows: [ OK ] 0.42 sec. 2026-03-19 05:46:47 00825_protobuf_format_persons: [ OK ] 7.04 sec. 2026-03-19 05:46:47 01269_create_with_null: [ OK ] 0.32 sec. 2026-03-19 05:46:47 01035_prewhere_with_alias: [ OK ] 0.37 sec. 2026-03-19 05:46:47 01328_bad_peephole_optimization: [ OK ] 0.32 sec. 2026-03-19 05:46:47 02813_array_agg: [ OK ] 0.27 sec. 2026-03-19 05:46:47 01318_alter_add_column_exists: [ OK ] 0.27 sec. 2026-03-19 05:46:47 02908_filesystem_cache_as_collection: [ OK ] 0.37 sec. 2026-03-19 05:46:47 01825_new_type_json_in_array: [ OK ] 0.42 sec. 2026-03-19 05:46:48 00460_vertical_and_totals_extremes: [ OK ] 0.32 sec. 2026-03-19 05:46:48 01580_column_const_comparision: [ OK ] 0.37 sec. 2026-03-19 05:46:48 03040_recursive_cte_postgres_6: [ OK ] 0.62 sec. 2026-03-19 05:46:48 02243_make_date32: [ OK ] 0.67 sec. 2026-03-19 05:46:48 00652_mutations_alter_update: [ OK ] 11.45 sec. 2026-03-19 05:46:48 01144_multiple_joins_rewriter_v2_and_lambdas: [ OK ] 0.32 sec. 2026-03-19 05:46:48 01018_Distributed__shard_num: [ OK ] 0.52 sec. 2026-03-19 05:46:48 03205_json_syntax: [ OK ] 0.42 sec. 2026-03-19 05:46:49 03263_analyzer_materialized_view_cte_nested: [ OK ] 0.32 sec. 2026-03-19 05:46:49 00298_enum_width_and_cast: [ OK ] 0.37 sec. 2026-03-19 05:46:49 02412_nlp: [ OK ] 0.37 sec. 2026-03-19 05:46:49 02341_global_join_cte: [ OK ] 0.42 sec. 2026-03-19 05:46:49 02504_regexp_dictionary_ua_parser: [ OK ] 3.18 sec. 2026-03-19 05:46:49 00831_quantile_weighted_parameter_check: [ OK ] 0.37 sec. 2026-03-19 05:46:49 01682_gather_utils_ubsan: [ OK ] 0.27 sec. 2026-03-19 05:46:49 02456_test_zero_copy_mutation: [ OK ] 0.42 sec. 2026-03-19 05:46:50 01292_quantile_array_bug: [ OK ] 0.32 sec. 2026-03-19 05:46:50 02811_parallel_replicas_prewhere_count: [ OK ] 0.32 sec. 2026-03-19 05:46:50 01622_constraints_where_optimization: [ OK ] 0.42 sec. 2026-03-19 05:46:51 02285_hex_bin_support_more_types: [ OK ] 0.42 sec. 2026-03-19 05:46:51 02013_zlib_read_after_eof: [ OK ] 2.18 sec. 2026-03-19 05:46:51 02841_not_ready_set_bug: [ OK ] 2.73 sec. 2026-03-19 05:46:51 01015_empty_in_inner_right_join: [ OK ] 0.52 sec. 2026-03-19 05:46:51 02400_memory_accounting_on_error: [ OK ] 0.67 sec. 2026-03-19 05:46:52 00009_array_join_subquery: [ OK ] 0.32 sec. 2026-03-19 05:46:52 01083_cross_to_inner_with_in_bug: [ OK ] 0.32 sec. 2026-03-19 05:46:52 01513_count_without_select_sequence_consistency_zookeeper_long: [ OK ] 0.52 sec. 2026-03-19 05:46:54 02096_bad_options_in_client_and_local: [ OK ] 1.77 sec. 2026-03-19 05:46:56 02918_multif_for_nullable: [ OK ] 1.77 sec. 2026-03-19 05:46:56 01460_line_as_string_format: [ OK ] 7.69 sec. 2026-03-19 05:46:56 01925_jit_aggregation_function_count_long: [ OK ] 0.42 sec. 2026-03-19 05:46:56 02911_cte_invalid_query_analysis: [ OK ] 0.37 sec. 2026-03-19 05:46:56 00540_bad_data_types: [ OK ] 5.08 sec. 2026-03-19 05:46:57 00028_shard_big_agg_aj_distributed: [ OK ] 0.37 sec. 2026-03-19 05:46:57 02177_issue_31009: [ SKIPPED ] 0.00 sec. 2026-03-19 05:46:57 Reason: not running for current build 2026-03-19 05:46:57 02916_set_formatting: [ OK ] 0.27 sec. 2026-03-19 05:46:57 01040_dictionary_invalidate_query_switchover_long: [ OK ] 15.71 sec. 2026-03-19 05:46:57 00978_ml_math: [ OK ] 0.32 sec. 2026-03-19 05:46:57 02579_parameterized_replace: [ OK ] 0.27 sec. 2026-03-19 05:46:57 00978_sum_map_bugfix: [ OK ] 0.42 sec. 2026-03-19 05:46:57 00161_rounding_functions: [ OK ] 0.62 sec. 2026-03-19 05:46:57 01071_in_array: [ OK ] 0.42 sec. 2026-03-19 05:46:58 00102_insert_into_temporary_table: [ OK ] 0.37 sec. 2026-03-19 05:46:58 01544_file_engine_settings: [ OK ] 1.02 sec. 2026-03-19 05:46:58 00239_type_conversion_in_in: [ OK ] 0.32 sec. 2026-03-19 05:46:58 02734_big_int_from_float_ubsan: [ OK ] 0.32 sec. 2026-03-19 05:46:58 00213_multiple_global_in: [ OK ] 0.27 sec. 2026-03-19 05:46:58 02538_analyzer_create_table_as_select: [ OK ] 0.37 sec. 2026-03-19 05:46:58 01326_build_id: [ OK ] 0.32 sec. 2026-03-19 05:46:58 01051_same_name_alias_with_joins: [ OK ] 0.42 sec. 2026-03-19 05:46:59 02125_transform_decimal_bug: [ OK ] 0.42 sec. 2026-03-19 05:47:00 02815_no_throw_in_simple_queries: [ FAIL ] 1.97 sec. 2026-03-19 05:47:00 Reason: return code: 1 2026-03-19 05:47:00 send: spawn id exp3 not open 2026-03-19 05:47:00 while executing 2026-03-19 05:47:00 "send -- "exit\r"" 2026-03-19 05:47:00 , result: 2026-03-19 05:47:00 2026-03-19 05:47:00 Failed 2026-03-19 05:47:00 Failed 2026-03-19 05:47:00 Failed 2026-03-19 05:47:00 Failed 2026-03-19 05:47:00 Failed 2026-03-19 05:47:00 Failed 2026-03-19 05:47:00 Failed 2026-03-19 05:47:00 Failed 2026-03-19 05:47:00 2026-03-19 05:47:00 stdout: 2026-03-19 05:47:00 Failed 2026-03-19 05:47:00 Failed 2026-03-19 05:47:00 Failed 2026-03-19 05:47:00 Failed 2026-03-19 05:47:00 Failed 2026-03-19 05:47:00 Failed 2026-03-19 05:47:00 Failed 2026-03-19 05:47:00 Failed 2026-03-19 05:47:00 2026-03-19 05:47:00 2026-03-19 05:47:00 Settings used in the test: --max_insert_threads 2 --group_by_two_level_threshold 832748 --group_by_two_level_threshold_bytes 1234489 --distributed_aggregation_memory_efficient 1 --fsync_metadata 0 --output_format_parallel_formatting 0 --input_format_parallel_parsing 0 --min_chunk_bytes_for_parallel_parsing 14360964 --max_read_buffer_size 695728 --prefer_localhost_replica 1 --max_block_size 23636 --max_joined_block_size_rows 20890 --max_threads 2 --optimize_append_index 0 --optimize_if_chain_to_multiif 0 --optimize_if_transform_strings_to_enum 0 --optimize_read_in_order 1 --optimize_or_like_chain 1 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 75 --optimize_aggregation_in_order 0 --aggregation_in_order_max_block_bytes 29221627 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 10737418240 --min_bytes_to_use_mmap_io 1 --local_filesystem_read_method io_uring --remote_filesystem_read_method threadpool --local_filesystem_read_prefetch 1 --filesystem_cache_segments_batch_size 3 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 0 --remote_filesystem_read_prefetch 0 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 128Mi --filesystem_prefetches_limit 10 --filesystem_prefetch_min_bytes_for_single_read_task 1Mi --filesystem_prefetch_step_marks 0 --filesystem_prefetch_step_bytes 100Mi --compile_aggregate_expressions 1 --compile_sort_description 1 --merge_tree_coarse_index_granularity 13 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 10737418240 --max_bytes_before_external_group_by 10737418240 --max_bytes_before_remerge_sort 798017043 --min_compress_block_size 168594 --max_compress_block_size 1778675 --merge_tree_compact_parts_min_granules_to_multibuffer_read 78 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 1713734 --http_wait_end_of_query False --enable_memory_bound_merging_of_aggregation_results 0 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 0 --session_timezone Pacific/Kiritimati --use_page_cache_for_disks_without_file_cache False --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.3 --prefer_external_sort_block_bytes 0 --cross_join_min_rows_to_compress 0 --cross_join_min_bytes_to_compress 0 --min_external_table_block_size_bytes 0 --max_parsing_threads 1 --optimize_functions_to_subcolumns 0 --parallel_replicas_local_plan 0 2026-03-19 05:47:00 2026-03-19 05:47:00 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 0.0 --prefer_fetch_merged_part_size_threshold 10737418240 --vertical_merge_algorithm_min_rows_to_activate 1000000 --vertical_merge_algorithm_min_columns_to_activate 100 --allow_vertical_merges_from_compact_to_wide_parts 1 --min_merge_bytes_to_use_direct_io 1 --index_granularity_bytes 12320349 --merge_max_block_size 5404 --index_granularity 33235 --min_bytes_for_wide_part 562280941 --marks_compress_block_size 22384 --primary_key_compress_block_size 45459 --replace_long_file_name_to_hash 0 --max_file_name_length 0 --min_bytes_for_full_part_storage 406913152 --compact_parts_max_bytes_to_buffer 77528026 --compact_parts_max_granules_to_buffer 159 --compact_parts_merge_max_bytes_to_prefetch_part 13856061 --cache_populated_by_fetch 1 --concurrent_part_removal_threshold 24 --old_parts_lifetime 10 2026-03-19 05:47:00 2026-03-19 05:47:00 Database: test_cjzcouni 2026-03-19 05:47:01 02884_string_distance_function: [ OK ] 0.57 sec. 2026-03-19 05:47:01 02732_rename_after_processing: [ OK ] 3.48 sec. 2026-03-19 05:47:01 03022_alter_materialized_view_query_has_inner_table: [ OK ] 0.37 sec. 2026-03-19 05:47:02 02481_async_insert_dedup_token: [ OK ] 89.25 sec. 2026-03-19 05:47:02 01871_merge_tree_compile_expressions: [ OK ] 0.72 sec. 2026-03-19 05:47:02 02918_optimize_count_for_merge_tables: [ OK ] 0.37 sec. 2026-03-19 05:47:03 01926_bin_unbin: [ OK ] 0.47 sec. 2026-03-19 05:47:03 01508_format_regexp_raw: [ OK ] 1.42 sec. 2026-03-19 05:47:03 02409_url_format_detection: [ OK ] 0.27 sec. 2026-03-19 05:47:03 02560_tuple_format: [ OK ] 0.78 sec. 2026-03-19 05:47:03 01059_storage_file_compression: [ OK ] 14.51 sec. 2026-03-19 05:47:03 03098_prefer_column_to_alias_subquery: [ OK ] 0.62 sec. 2026-03-19 05:47:04 02771_if_constant_folding: [ OK ] 0.32 sec. 2026-03-19 05:47:04 03261_json_hints_types_check: [ OK ] 0.37 sec. 2026-03-19 05:47:04 01010_partial_merge_join: [ OK ] 1.22 sec. 2026-03-19 05:47:04 01641_memory_tracking_insert_optimize: [ OK ] 0.62 sec. 2026-03-19 05:47:04 00975_sample_prewhere_distributed: [ OK ] 0.37 sec. 2026-03-19 05:47:04 00210_insert_select_extremes_http: [ OK ] 0.57 sec. 2026-03-19 05:47:05 01274_alter_rename_column_distributed: [ OK ] 0.42 sec. 2026-03-19 05:47:05 02475_analysis_of_variance: [ OK ] 0.37 sec. 2026-03-19 05:47:05 00320_between: [ OK ] 0.27 sec. 2026-03-19 05:47:05 03018_analyzer_distributed_query_with_positional_arguments: [ OK ] 0.42 sec. 2026-03-19 05:47:05 03291_json_big_structure_deserialization: [ OK ] 6.49 sec. 2026-03-19 05:47:05 02985_minmax_index_aggregate_function: [ OK ] 0.37 sec. 2026-03-19 05:47:05 01069_database_memory: [ OK ] 0.32 sec. 2026-03-19 05:47:06 00231_format_vertical_raw: [ OK ] 0.32 sec. 2026-03-19 05:47:06 00700_decimal_formats: [ OK ] 0.37 sec. 2026-03-19 05:47:06 00909_arrayEnumerateUniq: [ OK ] 1.47 sec. 2026-03-19 05:47:07 01044_h3_edge_angle: [ OK ] 0.53 sec. 2026-03-19 05:47:07 02346_into_outfile_and_stdout: [ OK ] 3.23 sec. 2026-03-19 05:47:08 02302_projections_GROUP_BY_ORDERY_BY_optimize_aggregation_in_order: [ OK ] 0.84 sec. 2026-03-19 05:47:08 02815_alias_to_length: [ OK ] 0.68 sec. 2026-03-19 05:47:08 02921_file_engine_size_virtual_column: [ OK ] 2.17 sec. 2026-03-19 05:47:08 01256_misspell_layout_name_podshumok: [ OK ] 0.49 sec. 2026-03-19 05:47:08 00898_parsing_bad_diagnostic_message: [ OK ] 2.25 sec. 2026-03-19 05:47:09 02385_analyzer_aliases_compound_expression: [ OK ] 0.70 sec. 2026-03-19 05:47:10 02950_reading_array_tuple_subcolumns: [ OK ] 1.05 sec. 2026-03-19 05:47:10 01470_explain: [ OK ] 0.48 sec. 2026-03-19 05:47:10 01845_add_testcase_for_arrayElement: [ OK ] 0.59 sec. 2026-03-19 05:47:11 00348_tuples: [ OK ] 0.79 sec. 2026-03-19 05:47:13 01395_limit_more_cases: [ OK ] 22.88 sec. 2026-03-19 05:47:13 03250_SYSTEM_DROP_FORMAT_SCHEMA_CACHE_FOR_Protobuf: [ OK ] 21.25 sec. 2026-03-19 05:47:14 02122_parallel_formatting_JSONCompactStrings: [ OK ] 5.78 sec. 2026-03-19 05:47:14 00069_date_arithmetic: [ OK ] 0.63 sec. 2026-03-19 05:47:15 02875_merge_engine_set_index: [ OK ] 5.21 sec. 2026-03-19 05:47:15 03153_format_regexp_usability: [ OK ] 2.45 sec. 2026-03-19 05:47:15 02473_multistep_prewhere: [ OK ] 17.74 sec. 2026-03-19 05:47:16 00218_like_regexp_newline: [ OK ] 0.65 sec. 2026-03-19 05:47:16 00234_disjunctive_equality_chains_optimization: [ OK ] 0.79 sec. 2026-03-19 05:47:18 02721_parquet_field_not_found: [ OK ] 2.49 sec. 2026-03-19 05:47:19 02346_fulltext_index_search: [ OK ] 4.88 sec. 2026-03-19 05:47:21 01825_new_type_json_multiple_files: [ OK ] 9.67 sec. 2026-03-19 05:47:21 01054_random_printable_ascii_ubsan: [ OK ] 5.26 sec. 2026-03-19 05:47:22 02525_analyzer_function_in_crash_fix: [ OK ] 0.64 sec. 2026-03-19 05:47:22 03093_bug_gcd_codec: [ OK ] 1.10 sec. 2026-03-19 05:47:23 00251_has_types: [ OK ] 0.94 sec. 2026-03-19 05:47:23 02785_left_anti_join_bug: [ OK ] 0.75 sec. 2026-03-19 05:47:24 01359_geodistance_loop: [ OK ] 0.69 sec. 2026-03-19 05:47:24 02480_analyzer_alias_nullptr: [ OK ] 0.64 sec. 2026-03-19 05:47:24 03012_parser_backtracking: [ OK ] 10.36 sec. 2026-03-19 05:47:24 01710_projection_drop_if_exists: [ OK ] 0.53 sec. 2026-03-19 05:47:25 01528_clickhouse_local_prepare_parts: [ OK ] 8.94 sec. 2026-03-19 05:47:25 01616_untuple_access_field: [ OK ] 0.84 sec. 2026-03-19 05:47:25 00753_alter_destination_for_storage_buffer: [ OK ] 1.04 sec. 2026-03-19 05:47:26 03145_unicode_quotes: [ OK ] 0.54 sec. 2026-03-19 05:47:26 00534_functions_bad_arguments8: [ SKIPPED ] 0.00 sec. 2026-03-19 05:47:26 Reason: not running for current build 2026-03-19 05:47:26 01913_names_of_tuple_literal: [ OK ] 0.70 sec. 2026-03-19 05:47:26 03008_deduplication_insert_into_partitioned_table: [ OK ] 2.25 sec. 2026-03-19 05:47:26 00570_empty_array_is_const: [ OK ] 1.04 sec. 2026-03-19 05:47:26 00737_decimal_group_by: [ OK ] 0.52 sec. 2026-03-19 05:47:27 02493_analyzer_table_functions_untuple: [ OK ] 0.53 sec. 2026-03-19 05:47:27 01802_rank_corr_mann_whitney_over_window: [ OK ] 0.93 sec. 2026-03-19 05:47:27 01585_fuzz_bits_with_bugfix: [ OK ] 0.68 sec. 2026-03-19 05:47:27 02681_undrop_query_uuid: [ OK ] 9.39 sec. 2026-03-19 05:47:28 00321_pk_set: [ OK ] 0.59 sec. 2026-03-19 05:47:28 02560_analyzer_materialized_view: [ OK ] 1.21 sec. 2026-03-19 05:47:28 02294_decimal_second_errors: [ OK ] 0.74 sec. 2026-03-19 05:47:28 01079_alter_default_zookeeper_long: [ OK ] 1.19 sec. 2026-03-19 05:47:29 03199_has_lc_fixed_string: [ OK ] 0.73 sec. 2026-03-19 05:47:29 02354_vector_search_legacy_index_compatibility: [ OK ] 1.10 sec. 2026-03-19 05:47:29 00542_access_to_temporary_table_in_readonly_mode: [ OK ] 0.61 sec. 2026-03-19 05:47:30 00729_prewhere_array_join: [ OK ] 1.44 sec. 2026-03-19 05:47:30 00934_is_valid_utf8: [ OK ] 2.06 sec. 2026-03-19 05:47:30 00060_date_lut: [ OK ] 0.74 sec. 2026-03-19 05:47:31 01943_query_id_check: [ OK ] 1.90 sec. 2026-03-19 05:47:31 00878_join_unexpected_results: [ OK ] 1.55 sec. 2026-03-19 05:47:32 00392_enum_nested_alter: [ OK ] 1.74 sec. 2026-03-19 05:47:32 00974_full_outer_join: [ OK ] 0.79 sec. 2026-03-19 05:47:33 02479_if_with_null_and_cullable_const: [ OK ] 0.62 sec. 2026-03-19 05:47:33 02983_empty_map: [ OK ] 1.49 sec. 2026-03-19 05:47:33 02883_zookeeper_finalize_stress: [ OK ] 14.14 sec. 2026-03-19 05:47:33 02944_variant_as_common_type_analyzer: [ OK ] 0.94 sec. 2026-03-19 05:47:34 01821_to_date_time_ubsan: [ OK ] 0.82 sec. 2026-03-19 05:47:34 02317_functions_with_nothing: [ OK ] 0.62 sec. 2026-03-19 05:47:34 02931_ubsan_error_arena_aligned_alloc: [ OK ] 0.68 sec. 2026-03-19 05:47:34 02995_index_5: [ SKIPPED ] 0.00 sec. 2026-03-19 05:47:34 Reason: not running for current build 2026-03-19 05:47:35 03087_analyzer_subquery_with_alias: [ OK ] 0.94 sec. 2026-03-19 05:47:35 01783_merge_engine_join_key_condition: [ OK ] 0.64 sec. 2026-03-19 05:47:35 01458_is_decimal_overflow: [ OK ] 0.95 sec. 2026-03-19 05:47:36 01473_system_events_zeroes: [ OK ] 0.79 sec. 2026-03-19 05:47:36 00181_aggregate_functions_statistics_stable: [ OK ] 1.15 sec. 2026-03-19 05:47:36 00522_multidimensional: [ OK ] 1.50 sec. 2026-03-19 05:47:36 01220_scalar_optimization_in_alter: [ OK ] 0.49 sec. 2026-03-19 05:47:36 01019_alter_materialized_view_atomic: [ SKIPPED ] 0.00 sec. 2026-03-19 05:47:36 Reason: not running for current build 2026-03-19 05:47:36 01440_big_int_shift: [ OK ] 0.32 sec. 2026-03-19 05:47:37 01702_system_numbers_scientific_notation: [ OK ] 0.42 sec. 2026-03-19 05:47:37 03197_storage_join_strictness_type_restriction: [ OK ] 0.42 sec. 2026-03-19 05:47:38 00991_system_parts_race_condition_long: [ OK ] 32.99 sec. 2026-03-19 05:47:38 02971_functions_to_subcolumns_variant: [ OK ] 2.09 sec. 2026-03-19 05:47:38 00910_decimal_group_array_crash_3783: [ OK ] 1.58 sec. 2026-03-19 05:47:38 00719_parallel_ddl_db: [ OK ] 30.45 sec. 2026-03-19 05:47:38 01622_constraints_simple_optimization: [ OK ] 1.13 sec. 2026-03-19 05:47:38 02675_predicate_push_down_filled_join_fix: [ OK ] 0.32 sec. 2026-03-19 05:47:38 01825_type_json_in_other_types: [ OK ] 5.11 sec. 2026-03-19 05:47:38 00662_has_nullable: [ OK ] 0.32 sec. 2026-03-19 05:47:38 02911_add_index_and_materialize_index: [ OK ] 0.32 sec. 2026-03-19 05:47:38 03199_queries_with_new_analyzer: [ OK ] 0.37 sec. 2026-03-19 05:47:39 01251_string_comparison: [ OK ] 0.27 sec. 2026-03-19 05:47:39 02494_optimize_group_by_function_keys_and_alias_columns: [ OK ] 0.32 sec. 2026-03-19 05:47:39 00356_analyze_aggregations_and_union_all: [ OK ] 0.32 sec. 2026-03-19 05:47:39 02841_join_filter_set_sparse: [ OK ] 0.42 sec. 2026-03-19 05:47:39 01703_rewrite_aggregate_function_case_insensitive: [ OK ] 0.37 sec. 2026-03-19 05:47:39 02128_cast_nullable: [ OK ] 0.32 sec. 2026-03-19 05:47:39 02553_new_type_json_attach_partition: [ OK ] 0.32 sec. 2026-03-19 05:47:39 02812_pointwise_array_operations: [ OK ] 0.57 sec. 2026-03-19 05:47:39 03144_invalid_filter: [ OK ] 0.32 sec. 2026-03-19 05:47:39 01421_array_nullable_element_nullable_index: [ OK ] 0.33 sec. 2026-03-19 05:47:39 00086_concat_nary_const_with_nonconst_segfault: [ OK ] 0.42 sec. 2026-03-19 05:47:39 03287_dynamic_and_json_squashing_fix: [ OK ] 0.42 sec. 2026-03-19 05:47:40 01376_array_fill_empty: [ OK ] 0.32 sec. 2026-03-19 05:47:40 00942_mv_rename_table: [ OK ] 0.37 sec. 2026-03-19 05:47:40 02241_short_circuit_short_column: [ OK ] 0.42 sec. 2026-03-19 05:47:40 03246_skipping_index_70108: [ OK ] 0.82 sec. 2026-03-19 05:47:40 01359_codeql: [ OK ] 0.37 sec. 2026-03-19 05:47:40 00622_select_in_parens: [ OK ] 0.27 sec. 2026-03-19 05:47:40 01837_cast_to_array_from_empty_array: [ OK ] 0.42 sec. 2026-03-19 05:47:40 02478_analyzer_table_expression_aliases: [ OK ] 0.37 sec. 2026-03-19 05:47:40 01925_merge_prewhere_table: [ OK ] 0.37 sec. 2026-03-19 05:47:40 02973_parse_crlf_with_tsv_files: [ OK ] 1.42 sec. 2026-03-19 05:47:41 01780_column_sparse_full: [ OK ] 0.77 sec. 2026-03-19 05:47:41 01416_clear_column_pk: [ OK ] 0.32 sec. 2026-03-19 05:47:41 01430_fix_any_rewrite_aliases: [ OK ] 0.27 sec. 2026-03-19 05:47:41 03143_parallel_replicas_mat_view_bug: [ OK ] 0.37 sec. 2026-03-19 05:47:41 02714_async_inserts_empty_data: [ OK ] 2.42 sec. 2026-03-19 05:47:41 02915_sleep_large_uint: [ OK ] 0.27 sec. 2026-03-19 05:47:41 01202_array_auc_special: [ OK ] 0.37 sec. 2026-03-19 05:47:41 00779_all_right_join_max_block_size: [ OK ] 0.37 sec. 2026-03-19 05:47:41 00688_low_cardinality_syntax: [ OK ] 0.52 sec. 2026-03-19 05:47:42 03198_bit_shift_throws_error_for_out_of_bounds: [ OK ] 0.52 sec. 2026-03-19 05:47:42 01274_generate_random_nested: [ OK ] 0.62 sec. 2026-03-19 05:47:42 03006_async_insert_deadlock_log: [ OK ] 1.67 sec. 2026-03-19 05:47:42 00940_order_by_read_in_order: [ OK ] 0.72 sec. 2026-03-19 05:47:42 00971_merge_tree_uniform_read_distribution_and_max_rows_to_read: [ OK ] 0.32 sec. 2026-03-19 05:47:43 03203_optimize_disjunctions_chain_to_in: [ OK ] 0.42 sec. 2026-03-19 05:47:43 02233_interpolate_1: [ OK ] 0.47 sec. 2026-03-19 05:47:43 02998_primary_key_skip_columns: [ SKIPPED ] 0.00 sec. 2026-03-19 05:47:43 Reason: not running for current build 2026-03-19 05:47:43 03003_compatibility_setting_bad_value: [ OK ] 0.27 sec. 2026-03-19 05:47:43 02155_dictionary_comment: [ OK ] 0.42 sec. 2026-03-19 05:47:44 02267_jsonlines_ndjson_format: [ OK ] 0.42 sec. 2026-03-19 05:47:44 00700_to_decimal_or_something_1: [ OK ] 1.28 sec. 2026-03-19 05:47:45 00904_array_with_constant_2: [ OK ] 0.37 sec. 2026-03-19 05:47:45 02540_date_column_consistent_insert_behaviour: [ OK ] 0.93 sec. 2026-03-19 05:47:45 02560_vertical_merge_memory_usage: [ OK ] 3.28 sec. 2026-03-19 05:47:46 02967_parallel_replicas_join_algo_and_analyzer_1: [ OK ] 4.43 sec. 2026-03-19 05:47:46 00113_shard_group_array: [ OK ] 4.09 sec. 2026-03-19 05:47:46 02751_query_log_test_partitions: [ OK ] 0.80 sec. 2026-03-19 05:47:46 01683_dist_INSERT_block_structure_mismatch: [ OK ] 0.42 sec. 2026-03-19 05:47:46 02203_shebang: [ OK ] 0.82 sec. 2026-03-19 05:47:47 01710_projection_with_column_transformers: [ OK ] 0.35 sec. 2026-03-19 05:47:47 03284_json_object_as_tuple_duplicate_keys: [ OK ] 0.47 sec. 2026-03-19 05:47:48 02538_alter_rename_sequence: [ OK ] 0.73 sec. 2026-03-19 05:47:48 00446_clear_column_in_partition_concurrent_zookeeper: [ OK ] 20.84 sec. 2026-03-19 05:47:49 03020_output_format_client: [ OK ] 2.63 sec. 2026-03-19 05:47:49 03207_json_read_subcolumns_1_wide_merge_tree: [ OK ] 3.59 sec. 2026-03-19 05:47:49 02514_tsv_zero_started_number: [ OK ] 0.32 sec. 2026-03-19 05:47:49 02135_local_create_db: [ OK ] 0.88 sec. 2026-03-19 05:47:49 02046_low_cardinality_parallel_group_by: [ OK ] 4.49 sec. 2026-03-19 05:47:49 01632_max_partitions_to_read: [ OK ] 0.32 sec. 2026-03-19 05:47:49 01700_point_in_polygon_ubsan: [ OK ] 0.37 sec. 2026-03-19 05:47:49 00476_pretty_formats_and_widths: [ OK ] 0.37 sec. 2026-03-19 05:47:49 01125_dict_ddl_cannot_add_column: [ OK ] 0.27 sec. 2026-03-19 05:47:50 02959_system_database_engines: [ OK ] 0.27 sec. 2026-03-19 05:47:50 01669_test_toYear_mysql_dialect: [ OK ] 0.32 sec. 2026-03-19 05:47:50 01508_race_condition_rename_clear_zookeeper_long: [ OK ] 19.92 sec. 2026-03-19 05:47:50 01782_field_oom: [ OK ] 3.98 sec. 2026-03-19 05:47:50 00808_not_optimize_predicate: [ OK ] 0.52 sec. 2026-03-19 05:47:50 01640_distributed_async_insert_compression: [ OK ] 0.32 sec. 2026-03-19 05:47:50 01060_defaults_all_columns: [ OK ] 0.37 sec. 2026-03-19 05:47:50 02922_respect_nulls_extensive: [ OK ] 0.82 sec. 2026-03-19 05:47:50 00623_in_partition_key: [ OK ] 0.67 sec. 2026-03-19 05:47:51 02420_stracktrace_debug_symbols: [ OK ] 0.97 sec. 2026-03-19 05:47:51 02007_join_use_nulls: [ OK ] 0.37 sec. 2026-03-19 05:47:51 01593_insert_settings: [ OK ] 0.47 sec. 2026-03-19 05:47:51 02989_variant_comparison: [ OK ] 0.67 sec. 2026-03-19 05:47:51 02833_tuple_concat: [ OK ] 0.42 sec. 2026-03-19 05:47:51 00882_multiple_join_no_alias: [ OK ] 0.37 sec. 2026-03-19 05:47:51 02381_parseDateTime64BestEffortUS: [ OK ] 0.37 sec. 2026-03-19 05:47:51 02696_ignore_inacc_tables_mat_view_atttach: [ OK ] 0.32 sec. 2026-03-19 05:47:51 00819_ast_refactoring_bugs: [ OK ] 0.32 sec. 2026-03-19 05:47:51 02374_in_tuple_index: [ OK ] 0.37 sec. 2026-03-19 05:47:52 02364_dictionary_datetime_64_attribute_crash: [ OK ] 0.32 sec. 2026-03-19 05:47:52 02533_generate_random_schema_inference: [ OK ] 0.37 sec. 2026-03-19 05:47:52 01278_variance_nonnegative: [ OK ] 0.47 sec. 2026-03-19 05:47:53 00908_long_http_insert: [ OK ] 1.02 sec. 2026-03-19 05:47:53 01093_cyclic_defaults_filimonov: [ OK ] 0.37 sec. 2026-03-19 05:47:53 01825_type_json_15: [ OK ] 2.58 sec. 2026-03-19 05:47:54 02392_every_setting_must_have_documentation: [ OK ] 0.32 sec. 2026-03-19 05:47:55 02125_lz4_compression_bug_JSONCompactEachRow: [ OK ] 5.03 sec. 2026-03-19 05:47:55 02809_prewhere_and_in: [ OK ] 0.53 sec. 2026-03-19 05:47:55 01926_order_by_desc_limit: [ OK ] 2.78 sec. 2026-03-19 05:47:56 02562_native_tskv_default_for_omitted_fields: [ OK ] 4.89 sec. 2026-03-19 05:47:56 00315_quantile_off_by_one: [ OK ] 0.42 sec. 2026-03-19 05:47:56 03031_input_format_allow_errors_num_bad_escape_sequence: [ OK ] 0.38 sec. 2026-03-19 05:47:56 00832_storage_file_lock: [ OK ] 0.32 sec. 2026-03-19 05:47:56 00135_duplicate_group_by_keys_segfault: [ OK ] 0.17 sec. 2026-03-19 05:47:56 00389_concat_operator: [ OK ] 0.37 sec. 2026-03-19 05:47:56 00111_shard_external_sort_distributed: [ OK ] 4.78 sec. 2026-03-19 05:47:56 03161_lightweight_delete_projection: [ OK ] 0.42 sec. 2026-03-19 05:47:57 01291_distributed_low_cardinality_memory_efficient: [ OK ] 0.32 sec. 2026-03-19 05:47:57 00726_materialized_view_concurrent: [ OK ] 0.37 sec. 2026-03-19 05:47:57 03325_distributed_join_json_array_subcolumns: [ OK ] 0.37 sec. 2026-03-19 05:47:57 02784_parallel_replicas_automatic_decision: [ OK ] 8.45 sec. 2026-03-19 05:47:57 02149_issue_32487: [ OK ] 0.27 sec. 2026-03-19 05:47:57 02969_auto_format_detection: [ OK ] 17.02 sec. 2026-03-19 05:47:57 01710_projection_detach_part: [ OK ] 0.27 sec. 2026-03-19 05:47:57 02875_parallel_replicas_remote: [ OK ] 0.62 sec. 2026-03-19 05:47:58 01041_h3_is_valid: [ OK ] 0.37 sec. 2026-03-19 05:47:58 02290_client_insert_cancel: [ OK ] 1.02 sec. 2026-03-19 05:47:58 02963_single_value_destructor: [ OK ] 0.47 sec. 2026-03-19 05:47:58 02572_max_intersections: [ OK ] 0.32 sec. 2026-03-19 05:47:58 00700_decimal_complex_types: [ OK ] 1.32 sec. 2026-03-19 05:47:58 01010_partial_merge_join_const_and_lc: [ OK ] 0.47 sec. 2026-03-19 05:47:58 02986_leftpad_fixedstring: [ OK ] 0.42 sec. 2026-03-19 05:47:59 02677_grace_hash_limit_race: [ OK ] 0.32 sec. 2026-03-19 05:47:59 03053_analyzer_join_alias: [ OK ] 0.32 sec. 2026-03-19 05:47:59 02575_merge_prewhere_materialized: [ OK ] 0.32 sec. 2026-03-19 05:47:59 01925_date_date_time_comparison: [ OK ] 0.32 sec. 2026-03-19 05:47:59 01280_min_map_max_map: [ OK ] 0.57 sec. 2026-03-19 05:47:59 01377_supertype_low_cardinality: [ OK ] 0.57 sec. 2026-03-19 05:47:59 00063_check_query: [ OK ] 0.42 sec. 2026-03-19 05:48:00 00673_subquery_prepared_set_performance: [ OK ] 0.72 sec. 2026-03-19 05:48:00 02003_memory_limit_in_client: [ OK ] 7.54 sec. 2026-03-19 05:48:01 00825_protobuf_format_array_3dim: [ OK ] 2.03 sec. 2026-03-19 05:48:01 00129_quantile_timing_weighted: [ OK ] 0.37 sec. 2026-03-19 05:48:01 02475_join_bug_42832: [ OK ] 0.37 sec. 2026-03-19 05:48:01 03135_keeper_client_find_commands: [ OK ] 1.12 sec. 2026-03-19 05:48:01 01773_datetime64_add_ubsan: [ OK ] 0.37 sec. 2026-03-19 05:48:01 02024_create_dictionary_with_comment: [ OK ] 0.27 sec. 2026-03-19 05:48:02 01791_dist_INSERT_block_structure_mismatch: [ OK ] 0.97 sec. 2026-03-19 05:48:02 00606_quantiles_and_nans: [ OK ] 0.32 sec. 2026-03-19 05:48:02 02133_final_prewhere_where_lowcardinality_replacing: [ OK ] 0.42 sec. 2026-03-19 05:48:02 02240_get_type_serialization_streams: [ OK ] 0.32 sec. 2026-03-19 05:48:02 03150_grouping_sets_use_nulls_pushdown: [ OK ] 0.37 sec. 2026-03-19 05:48:02 00055_join_two_numbers: [ OK ] 0.32 sec. 2026-03-19 05:48:03 00355_array_of_non_const_convertible_types: [ OK ] 0.32 sec. 2026-03-19 05:48:03 03001_data_version_column: [ OK ] 0.32 sec. 2026-03-19 05:48:03 01170_alter_partition_isolation: [ OK ] 3.98 sec. 2026-03-19 05:48:03 03032_rmt_create_columns_from_replica: [ OK ] 0.22 sec. 2026-03-19 05:48:03 01684_insert_specify_shard_id: [ OK ] 0.52 sec. 2026-03-19 05:48:03 03305_compressed_memory_eng_crash_reading_subcolumn: [ OK ] 0.27 sec. 2026-03-19 05:48:04 02968_mysql_prefer_column_name_to_alias: [ OK ] 0.62 sec. 2026-03-19 05:48:04 01788_update_nested_type_subcolumn_check: [ OK ] 0.67 sec. 2026-03-19 05:48:06 01721_join_implicit_cast_long: [ OK ] 4.43 sec. 2026-03-19 05:48:06 02874_analysis_of_variance_overflow: [ OK ] 0.27 sec. 2026-03-19 05:48:07 00952_input_function: [ OK ] 8.09 sec. 2026-03-19 05:48:08 02455_duplicate_column_names_in_schema_inference: [ OK ] 0.32 sec. 2026-03-19 05:48:08 01710_projections_optimize_aggregation_in_order: [ OK ] 5.23 sec. 2026-03-19 05:48:09 03164_adapting_parquet_reader_output_size: [ OK ] 0.87 sec. 2026-03-19 05:48:09 00900_orc_arrow_parquet_maps: [ OK ] 4.93 sec. 2026-03-19 05:48:09 03172_dynamic_binary_serialization: [ OK ] 15.46 sec. 2026-03-19 05:48:09 01785_parallel_formatting_memory: [ OK ] 1.27 sec. 2026-03-19 05:48:09 02152_dictionary_date32_type: [ OK ] 0.42 sec. 2026-03-19 05:48:09 00098_shard_i_union_all: [ OK ] 0.37 sec. 2026-03-19 05:48:11 02160_client_autocomplete_parse_query: [ OK ] 1.87 sec. 2026-03-19 05:48:12 00799_function_dry_run: [ OK ] 0.27 sec. 2026-03-19 05:48:12 03200_subcolumns_join_use_nulls: [ OK ] 0.37 sec. 2026-03-19 05:48:12 02221_system_zookeeper_unrestricted_like: [ OK ] 2.98 sec. 2026-03-19 05:48:13 01056_prepared_statements_null_and_escaping: [ OK ] 0.62 sec. 2026-03-19 05:48:13 01278_format_multiple_queries: [ OK ] 0.62 sec. 2026-03-19 05:48:13 02880_indexHint__partition_id: [ OK ] 0.32 sec. 2026-03-19 05:48:13 03215_varian_as_common_type_integers: [ OK ] 0.27 sec. 2026-03-19 05:48:14 02356_insert_query_log_metrics: [ OK ] 0.52 sec. 2026-03-19 05:48:14 02686_bson3: [ OK ] 0.27 sec. 2026-03-19 05:48:14 02050_clickhouse_local_parsing_exception: [ OK ] 0.67 sec. 2026-03-19 05:48:15 02871_join_on_system_errors: [ OK ] 0.27 sec. 2026-03-19 05:48:15 00964_bloom_index_string_functions: [ OK ] 8.54 sec. 2026-03-19 05:48:15 03054_analyzer_join_alias: [ OK ] 0.33 sec. 2026-03-19 05:48:15 00612_count: [ OK ] 0.42 sec. 2026-03-19 05:48:15 01662_join_mixed: [ OK ] 0.27 sec. 2026-03-19 05:48:15 02887_tuple_element_distributed: [ OK ] 0.27 sec. 2026-03-19 05:48:16 02122_parallel_formatting_JSONCompact: [ OK ] 1.92 sec. 2026-03-19 05:48:16 03015_peder1001: [ OK ] 0.42 sec. 2026-03-19 05:48:16 00679_uuid_in_key: [ OK ] 0.32 sec. 2026-03-19 05:48:16 01247_least_greatest_filimonov: [ OK ] 0.32 sec. 2026-03-19 05:48:16 01000_unneeded_substitutions_client: [ OK ] 0.77 sec. 2026-03-19 05:48:17 01812_optimize_skip_unused_shards_single_node: [ OK ] 0.27 sec. 2026-03-19 05:48:18 00925_zookeeper_empty_replicated_merge_tree_optimize_final_long: [ OK ] 2.52 sec. 2026-03-19 05:48:18 01058_window_view_event_hop_to_strict_asc: [ OK ] 2.43 sec. 2026-03-19 05:48:19 03203_system_numbers_limit_and_offset_complex: [ OK ] 0.32 sec. 2026-03-19 05:48:19 02994_merge_tree_mutations_cleanup: [ OK ] 10.40 sec. 2026-03-19 05:48:19 01710_projection_with_mixed_pipeline: [ OK ] 0.32 sec. 2026-03-19 05:48:19 03014_window_view_crash: [ OK ] 0.27 sec. 2026-03-19 05:48:19 00506_union_distributed: [ OK ] 0.47 sec. 2026-03-19 05:48:20 01035_avg: [ OK ] 3.03 sec. 2026-03-19 05:48:20 02382_join_and_filtering_set: [ OK ] 0.42 sec. 2026-03-19 05:48:20 01671_aggregate_function_group_bitmap_data: [ OK ] 0.32 sec. 2026-03-19 05:48:20 00853_join_with_nulls_crash: [ OK ] 0.37 sec. 2026-03-19 05:48:20 01825_type_json_3: [ OK ] 0.52 sec. 2026-03-19 05:48:21 02679_query_parameters_dangling_pointer: [ OK ] 0.27 sec. 2026-03-19 05:48:21 03034_normalized_ast: [ OK ] 0.33 sec. 2026-03-19 05:48:21 00900_long_parquet: [ OK ] 24.23 sec. 2026-03-19 05:48:21 00429_point_in_ellipses: [ OK ] 0.32 sec. 2026-03-19 05:48:21 01425_default_value_of_type_name: [ OK ] 0.33 sec. 2026-03-19 05:48:21 00989_parallel_parts_loading: [ OK ] 2.17 sec. 2026-03-19 05:48:21 03105_table_aliases_in_mv: [ OK ] 0.52 sec. 2026-03-19 05:48:21 01019_materialized_view_select_extra_columns: [ OK ] 0.43 sec. 2026-03-19 05:48:22 02052_last_granula_adjust_logical_error: [ OK ] 0.52 sec. 2026-03-19 05:48:22 02112_skip_index_set_and_or: [ OK ] 0.32 sec. 2026-03-19 05:48:22 02179_bool_type: [ OK ] 0.37 sec. 2026-03-19 05:48:22 02316_cast_to_ip_address_default_column: [ OK ] 0.37 sec. 2026-03-19 05:48:22 00661_array_has_silviucpp: [ OK ] 0.32 sec. 2026-03-19 05:48:22 03165_storage_merge_view_prewhere: [ OK ] 0.37 sec. 2026-03-19 05:48:22 02355_column_type_name_lc: [ OK ] 0.27 sec. 2026-03-19 05:48:24 00507_array_no_params: [ OK ] 1.37 sec. 2026-03-19 05:48:24 03036_dynamic_read_shared_subcolumns_memory: [ OK ] 5.48 sec. 2026-03-19 05:48:24 03041_analyzer_gigachad_join: [ OK ] 0.32 sec. 2026-03-19 05:48:24 02407_array_element_from_map_wrong_type: [ OK ] 0.27 sec. 2026-03-19 05:48:24 02535_ip_parser_not_whole: [ OK ] 0.27 sec. 2026-03-19 05:48:25 01554_interpreter_integer_float: [ OK ] 0.32 sec. 2026-03-19 05:48:25 02833_local_udf_options: [ OK ] 0.67 sec. 2026-03-19 05:48:26 02456_keeper_retries_during_insert: [ OK ] 1.62 sec. 2026-03-19 05:48:27 02271_replace_partition_many_tables: [ OK ] 30.65 sec. 2026-03-19 05:48:27 02242_make_date_mysql: [ OK ] 0.37 sec. 2026-03-19 05:48:27 02835_join_step_explain: [ OK ] 0.32 sec. 2026-03-19 05:48:27 02724_function_in_left_table_clause_asof_join: [ OK ] 0.27 sec. 2026-03-19 05:48:28 02454_disable_mergetree_with_lightweight_delete_column: [ OK ] 0.37 sec. 2026-03-19 05:48:28 01115_join_with_dictionary: [ OK ] 0.72 sec. 2026-03-19 05:48:28 01017_mutations_with_nondeterministic_functions_zookeeper: [ OK ] 3.23 sec. 2026-03-19 05:48:28 01521_max_length_alias: [ OK ] 0.27 sec. 2026-03-19 05:48:28 01678_great_circle_angle: [ OK ] 0.32 sec. 2026-03-19 05:48:28 01825_new_type_json_insert_select: [ OK ] 0.72 sec. 2026-03-19 05:48:28 02180_group_by_lowcardinality: [ OK ] 0.17 sec. 2026-03-19 05:48:29 02001_append_output_file: [ OK ] 0.92 sec. 2026-03-19 05:48:29 02245_make_datetime64: [ OK ] 0.67 sec. 2026-03-19 05:48:29 02477_age_date32: [ OK ] 0.47 sec. 2026-03-19 05:48:29 03062_analyzer_join_engine_missing_column: [ OK ] 0.32 sec. 2026-03-19 05:48:29 01710_order_by_projections_incomplete: [ OK ] 0.37 sec. 2026-03-19 05:48:29 01686_rocksdb: [ OK ] 0.47 sec. 2026-03-19 05:48:29 00358_from_string_complex_types: [ OK ] 0.27 sec. 2026-03-19 05:48:29 03208_array_of_json_read_subcolumns_2_wide_merge_tree: [ SKIPPED ] 0.00 sec. 2026-03-19 05:48:29 Reason: not running for current build 2026-03-19 05:48:30 01853_s2_cells_intersect: [ OK ] 0.32 sec. 2026-03-19 05:48:30 02378_part_log_profile_events: [ OK ] 0.77 sec. 2026-03-19 05:48:30 03094_one_thousand_joins: [ OK ] 7.69 sec. 2026-03-19 05:48:30 00534_functions_bad_arguments2: [ SKIPPED ] 0.00 sec. 2026-03-19 05:48:30 Reason: not running for current build 2026-03-19 05:48:30 03269_partition_key_not_in_set: [ OK ] 0.52 sec. 2026-03-19 05:48:30 01116_asof_join_dolbyzerr: [ OK ] 0.32 sec. 2026-03-19 05:48:30 02498_random_string_in_json_schema_inference: [ OK ] 0.62 sec. 2026-03-19 05:48:31 00280_hex_escape_sequence: [ OK ] 0.27 sec. 2026-03-19 05:48:31 03456_match_index_prefix_extraction: [ OK ] 0.67 sec. 2026-03-19 05:48:31 00700_decimal_with_default_precision_and_scale: [ OK ] 0.32 sec. 2026-03-19 05:48:31 01825_type_json_empty_string: [ OK ] 0.37 sec. 2026-03-19 05:48:31 03036_dynamic_read_shared_subcolumns_compact_merge_tree: [ OK ] 27.20 sec. 2026-03-19 05:48:32 01927_query_views_log_current_database: [ OK ] 0.87 sec. 2026-03-19 05:48:33 03206_is_null_constant_result_old_analyzer_bug: [ OK ] 0.28 sec. 2026-03-19 05:48:33 02267_file_globs_schema_inference: [ OK ] 2.33 sec. 2026-03-19 05:48:33 00335_bom: [ OK ] 0.62 sec. 2026-03-19 05:48:33 02956_rocksdb_with_ttl: [ OK ] 3.38 sec. 2026-03-19 05:48:33 03228_variant_permutation_issue: [ OK ] 0.42 sec. 2026-03-19 05:48:34 01250_fixed_string_comparison: [ OK ] 0.27 sec. 2026-03-19 05:48:34 03039_dynamic_aggregating_merge_tree: [ OK ] 12.40 sec. 2026-03-19 05:48:34 01710_aggregate_projection_with_monotonic_key_expr: [ OK ] 0.32 sec. 2026-03-19 05:48:34 02131_materialize_column_cast: [ OK ] 0.37 sec. 2026-03-19 05:48:34 02271_temporary_table_show_rows_bytes: [ OK ] 0.27 sec. 2026-03-19 05:48:35 02531_two_level_aggregation_bug: [ OK ] 1.37 sec. 2026-03-19 05:48:35 01457_order_by_nulls_first: [ OK ] 0.47 sec. 2026-03-19 05:48:35 01605_key_condition_enum_int: [ OK ] 0.27 sec. 2026-03-19 05:48:35 02121_pager: [ OK ] 0.92 sec. 2026-03-19 05:48:35 03013_repeat_with_nonnative_integers: [ OK ] 0.27 sec. 2026-03-19 05:48:35 00097_long_storage_buffer_race_condition: [ OK ] 13.05 sec. 2026-03-19 05:48:35 01774_bar_with_illegal_value: [ OK ] 0.27 sec. 2026-03-19 05:48:36 03093_filter_push_down_crash: [ OK ] 0.27 sec. 2026-03-19 05:48:36 01497_now_support_timezone: [ OK ] 0.27 sec. 2026-03-19 05:48:36 01545_url_file_format_settings: [ OK ] 0.42 sec. 2026-03-19 05:48:36 02916_csv_infer_numbers_from_strings: [ OK ] 0.27 sec. 2026-03-19 05:48:36 01410_full_join_and_null_predicates: [ OK ] 0.47 sec. 2026-03-19 05:48:36 00943_mv_rename_without_inner_table: [ OK ] 0.37 sec. 2026-03-19 05:48:36 02294_dictionaries_hierarchical_index: [ OK ] 0.42 sec. 2026-03-19 05:48:37 01710_minmax_count_projection_distributed_query: [ OK ] 0.37 sec. 2026-03-19 05:48:37 00143_number_classification_functions: [ OK ] 0.37 sec. 2026-03-19 05:48:37 00393_if_with_constant_condition: [ OK ] 0.37 sec. 2026-03-19 05:48:37 01518_nullable_aggregate_states2: [ OK ] 2.38 sec. 2026-03-19 05:48:37 02310_generate_multi_columns_with_uuid: [ OK ] 0.32 sec. 2026-03-19 05:48:38 02990_optimize_uniq_to_count_alias: [ OK ] 0.37 sec. 2026-03-19 05:48:38 03203_client_benchmark_options: [ OK ] 6.44 sec. 2026-03-19 05:48:38 02125_lz4_compression_bug_CSV: [ OK ] 4.48 sec. 2026-03-19 05:48:38 02346_read_in_order_fixed_prefix: [ OK ] 7.09 sec. 2026-03-19 05:48:38 01921_test_progress_bar: [ OK ] 0.47 sec. 2026-03-19 05:48:38 01634_summap_nullable: [ OK ] 0.37 sec. 2026-03-19 05:48:38 02810_fix_remove_dedundant_distinct_view: [ OK ] 0.42 sec. 2026-03-19 05:48:38 01073_bad_alter_partition: [ OK ] 0.47 sec. 2026-03-19 05:48:38 00712_prewhere_with_final: [ OK ] 0.32 sec. 2026-03-19 05:48:38 01293_external_sorting_limit_bug: [ OK ] 0.32 sec. 2026-03-19 05:48:38 02737_sql_auto_is_null: [ OK ] 0.28 sec. 2026-03-19 05:48:38 00910_zookeeper_test_alter_compression_codecs_long: [ OK ] 0.72 sec. 2026-03-19 05:48:38 02916_distributed_skip_unavailable_shards: [ OK ] 0.32 sec. 2026-03-19 05:48:39 00746_hashing_tuples: [ OK ] 0.42 sec. 2026-03-19 05:48:39 02782_avro_decimals: [ OK ] 0.87 sec. 2026-03-19 05:48:39 01799_long_uniq_theta_sketch: [ OK ] 2.48 sec. 2026-03-19 05:48:39 01851_array_difference_decimal_overflow_ubsan: [ OK ] 0.27 sec. 2026-03-19 05:48:39 03041_recursive_cte_postgres_7: [ OK ] 0.57 sec. 2026-03-19 05:48:39 01442_merge_detach_attach_long: [ SKIPPED ] 0.00 sec. 2026-03-19 05:48:39 Reason: not running for current build 2026-03-19 05:48:39 02710_protobuf_ipv4_date32: [ OK ] 1.08 sec. 2026-03-19 05:48:40 00552_or_nullable: [ OK ] 0.37 sec. 2026-03-19 05:48:40 02317_distinct_in_order_optimization: [ OK ] 1.62 sec. 2026-03-19 05:48:40 00059_shard_global_in: [ OK ] 0.47 sec. 2026-03-19 05:48:40 01106_const_fixed_string_like: [ OK ] 0.53 sec. 2026-03-19 05:48:40 01882_total_rows_approx: [ OK ] 1.73 sec. 2026-03-19 05:48:40 00467_qualified_names: [ OK ] 0.42 sec. 2026-03-19 05:48:40 00969_roundDuration: [ OK ] 0.48 sec. 2026-03-19 05:48:41 02021_exponential_sum_shard: [ OK ] 0.88 sec. 2026-03-19 05:48:41 02668_parse_datetime_in_joda_syntax: [ OK ] 1.13 sec. 2026-03-19 05:48:41 02943_order_by_all: [ OK ] 0.72 sec. 2026-03-19 05:48:41 02293_grouping_function_group_by: [ OK ] 0.72 sec. 2026-03-19 05:48:41 02720_row_policy_column_with_dots: [ OK ] 0.32 sec. 2026-03-19 05:48:41 03198_orc_read_time_zone: [ OK ] 2.08 sec. 2026-03-19 05:48:41 00712_nan_comparison: [ OK ] 0.47 sec. 2026-03-19 05:48:42 00980_crash_nullable_decimal: [ OK ] 0.27 sec. 2026-03-19 05:48:42 03215_parquet_index: [ OK ] 0.32 sec. 2026-03-19 05:48:42 01798_uniq_theta_sketch: [ OK ] 0.92 sec. 2026-03-19 05:48:42 00379_system_processes_port: [ OK ] 0.57 sec. 2026-03-19 05:48:42 00178_query_datetime64_index: [ OK ] 0.42 sec. 2026-03-19 05:48:42 02972_to_string_nullable_timezone: [ OK ] 0.35 sec. 2026-03-19 05:48:42 02418_keeper_map_keys_limit: [ OK ] 0.52 sec. 2026-03-19 05:48:42 02872_prewhere_filter: [ OK ] 0.33 sec. 2026-03-19 05:48:43 03167_parametrized_view_with_cte: [ OK ] 0.33 sec. 2026-03-19 05:48:43 02122_parallel_formatting_Markdown: [ OK ] 2.23 sec. 2026-03-19 05:48:43 01790_dist_INSERT_block_structure_mismatch_types_and_names: [ OK ] 0.63 sec. 2026-03-19 05:48:43 00527_totals_having_nullable: [ OK ] 0.32 sec. 2026-03-19 05:48:43 02013_emptystring_cast: [ OK ] 0.62 sec. 2026-03-19 05:48:44 01549_low_cardinality_materialized_view: [ OK ] 0.57 sec. 2026-03-19 05:48:44 02366_kql_func_dynamic: [ OK ] 1.49 sec. 2026-03-19 05:48:44 01050_engine_join_crash: [ OK ] 0.63 sec. 2026-03-19 05:48:44 00263_merge_aggregates_and_overflow: [ OK ] 0.48 sec. 2026-03-19 05:48:44 00834_not_between: [ OK ] 0.32 sec. 2026-03-19 05:48:45 00804_test_custom_compression_codes_log_storages: [ OK ] 0.93 sec. 2026-03-19 05:48:45 02346_position_countsubstrings_zero_byte: [ OK ] 0.59 sec. 2026-03-19 05:48:45 00700_decimal_arithm: [ OK ] 2.25 sec. 2026-03-19 05:48:45 00821_distributed_storage_with_join_on: [ OK ] 0.52 sec. 2026-03-19 05:48:46 00926_adaptive_index_granularity_collapsing_merge_tree: [ OK ] 0.69 sec. 2026-03-19 05:48:46 01961_roaring_memory_tracking: [ OK ] 3.40 sec. 2026-03-19 05:48:46 02540_duplicate_primary_key2: [ OK ] 0.42 sec. 2026-03-19 05:48:46 01954_clickhouse_benchmark_multiple_long: [ OK ] 9.61 sec. 2026-03-19 05:48:46 01903_http_fields: [ OK ] 1.58 sec. 2026-03-19 05:48:46 02112_delayed_clickhouse_local: [ OK ] 0.72 sec. 2026-03-19 05:48:46 02477_exists_fuzz_43478: [ OK ] 0.32 sec. 2026-03-19 05:48:46 02971_limit_by_distributed: [ OK ] 0.54 sec. 2026-03-19 05:48:46 01787_map_remote: [ OK ] 0.42 sec. 2026-03-19 05:48:47 00127_group_by_concat: [ OK ] 0.32 sec. 2026-03-19 05:48:47 01097_pre_limit: [ OK ] 0.37 sec. 2026-03-19 05:48:47 03165_parseReadableSize: [ OK ] 0.87 sec. 2026-03-19 05:48:47 00080_show_tables_and_system_tables: [ OK ] 0.37 sec. 2026-03-19 05:48:47 01470_columns_transformers2: [ OK ] 0.32 sec. 2026-03-19 05:48:47 00758_array_reverse: [ OK ] 0.37 sec. 2026-03-19 05:48:47 00457_log_tinylog_stripelog_nullable: [ OK ] 0.57 sec. 2026-03-19 05:48:47 01346_alter_enum_partition_key_replicated_zookeeper_long: [ OK ] 0.87 sec. 2026-03-19 05:48:47 02536_date_from_number_inference_fix: [ OK ] 0.37 sec. 2026-03-19 05:48:48 02205_postgresql_functions: [ OK ] 0.83 sec. 2026-03-19 05:48:48 02228_unquoted_dates_in_csv_schema_inference: [ OK ] 0.73 sec. 2026-03-19 05:48:48 02833_url_without_path_encoding: [ OK ] 1.33 sec. 2026-03-19 05:48:48 02008_materialize_column: [ OK ] 0.58 sec. 2026-03-19 05:48:49 02024_join_on_or_long: [ OK ] 1.38 sec. 2026-03-19 05:48:49 02990_arrayFold_nullable_lc: [ OK ] 0.48 sec. 2026-03-19 05:48:49 01513_optimize_aggregation_in_order_memory_long: [ OK ] 3.94 sec. 2026-03-19 05:48:49 03014_msan_parse_date_time: [ OK ] 0.32 sec. 2026-03-19 05:48:49 00071_insert_fewer_columns: [ OK ] 0.32 sec. 2026-03-19 05:48:49 02458_datediff_date32: [ OK ] 0.83 sec. 2026-03-19 05:48:49 01273_lc_fixed_string_field: [ OK ] 0.38 sec. 2026-03-19 05:48:50 02212_h3_get_pentagon_indexes: [ OK ] 0.42 sec. 2026-03-19 05:48:50 00732_decimal_summing_merge_tree: [ OK ] 0.52 sec. 2026-03-19 05:48:50 02859_replicated_db_name_zookeeper: [ OK ] 2.53 sec. 2026-03-19 05:48:50 03014_analyzer_groupby_fuzz_60317: [ OK ] 0.42 sec. 2026-03-19 05:48:50 01894_jit_aggregation_function_max_long: [ OK ] 1.58 sec. 2026-03-19 05:48:50 00380_client_break_at_exception_in_batch_mode: [ OK ] 0.97 sec. 2026-03-19 05:48:50 00468_array_join_multiple_arrays_and_use_original_column: [ OK ] 0.32 sec. 2026-03-19 05:48:51 02176_toStartOfWeek_overflow_pruning: [ OK ] 0.42 sec. 2026-03-19 05:48:51 00499_json_enum_insert: [ OK ] 0.32 sec. 2026-03-19 05:48:51 01925_map_populate_series_on_map: [ OK ] 0.57 sec. 2026-03-19 05:48:51 01318_encrypt: [ OK ] 0.92 sec. 2026-03-19 05:48:51 01063_create_column_set: [ OK ] 0.42 sec. 2026-03-19 05:48:51 01766_todatetime64_no_timezone_arg: [ OK ] 0.27 sec. 2026-03-19 05:48:51 03038_nested_dynamic_merges_wide_vertical: [ OK ] 3.23 sec. 2026-03-19 05:48:51 02151_lc_prefetch: [ SKIPPED ] 0.00 sec. 2026-03-19 05:48:51 Reason: not running for current build 2026-03-19 05:48:52 00980_merge_alter_settings: [ OK ] 0.47 sec. 2026-03-19 05:48:52 00829_bitmap_function: [ OK ] 1.07 sec. 2026-03-19 05:48:52 02966_nested_offsets_subcolumn: [ OK ] 0.72 sec. 2026-03-19 05:48:52 01632_tinylog_read_write: [ OK ] 10.68 sec. 2026-03-19 05:48:52 02381_analyzer_join_final: [ OK ] 0.47 sec. 2026-03-19 05:48:52 00667_compare_arrays_of_different_types: [ OK ] 0.32 sec. 2026-03-19 05:48:52 00752_low_cardinality_permute: [ OK ] 0.32 sec. 2026-03-19 05:48:52 01411_xor_itai_shirav: [ OK ] 0.27 sec. 2026-03-19 05:48:52 01356_initialize_aggregation: [ OK ] 0.32 sec. 2026-03-19 05:48:52 02706_kolmogorov_smirnov_test: [ OK ] 0.42 sec. 2026-03-19 05:48:53 03037_dynamic_merges_2_horizontal_compact_merge_tree: [ OK ] 0.62 sec. 2026-03-19 05:48:53 02535_json_bson_each_row_curl: [ OK ] 1.77 sec. 2026-03-19 05:48:53 02813_seriesDecomposeSTL: [ OK ] 0.47 sec. 2026-03-19 05:48:53 02897_alter_partition_parameters: [ OK ] 0.62 sec. 2026-03-19 05:48:53 01497_alias_on_default_array: [ OK ] 0.32 sec. 2026-03-19 05:48:53 02124_insert_deduplication_token_materialized_views: [ OK ] 1.27 sec. 2026-03-19 05:48:53 03443_projection_sparse: [ OK ] 0.37 sec. 2026-03-19 05:48:53 02551_obfuscator_keywords: [ OK ] 0.67 sec. 2026-03-19 05:48:53 01069_materialized_view_alter_target_table: [ OK ] 0.32 sec. 2026-03-19 05:48:53 03079_analyzer_numeric_literals_as_column_names: [ OK ] 0.27 sec. 2026-03-19 05:48:53 00558_aggregate_merge_totals_with_arenas: [ OK ] 0.27 sec. 2026-03-19 05:48:54 02566_analyzer_limit_settings_distributed: [ OK ] 0.37 sec. 2026-03-19 05:48:54 00488_column_name_primary: [ OK ] 0.32 sec. 2026-03-19 05:48:54 02244_ip_address_invalid_insert: [ OK ] 0.52 sec. 2026-03-19 05:48:54 01034_move_partition_from_table_zookeeper: [ OK ] 44.76 sec. 2026-03-19 05:48:54 01882_scalar_subquery_exception: [ OK ] 0.32 sec. 2026-03-19 05:48:54 02783_date_predicate_optimizations: [ OK ] 1.22 sec. 2026-03-19 05:48:54 02688_long_aggregate_function_names: [ OK ] 0.37 sec. 2026-03-19 05:48:54 00506_shard_global_in_union: [ OK ] 0.62 sec. 2026-03-19 05:48:55 02232_partition_pruner_mixed_constant_type: [ OK ] 0.42 sec. 2026-03-19 05:48:55 02487_create_index_normalize_functions: [ OK ] 0.48 sec. 2026-03-19 05:48:55 01656_ipv4_bad_formatting: [ OK ] 0.34 sec. 2026-03-19 05:48:55 02560_regexp_denial_of_service: [ OK ] 0.69 sec. 2026-03-19 05:48:55 03166_mv_prewhere_duplicating_name_bug: [ OK ] 0.32 sec. 2026-03-19 05:48:55 02933_group_by_memory_usage: [ OK ] 1.92 sec. 2026-03-19 05:48:56 02383_array_signed_const_positive_index: [ OK ] 0.32 sec. 2026-03-19 05:48:56 02131_row_policies_combination: [ OK ] 0.47 sec. 2026-03-19 05:48:56 02833_std_alias: [ OK ] 0.42 sec. 2026-03-19 05:48:56 03156_default_multiquery_split: [ OK ] 1.18 sec. 2026-03-19 05:48:56 01358_lc_parquet: [ OK ] 5.59 sec. 2026-03-19 05:48:56 00444_join_use_nulls: [ OK ] 0.37 sec. 2026-03-19 05:48:56 00975_recursive_materialized_view: [ OK ] 0.32 sec. 2026-03-19 05:48:56 02128_apply_lambda_parsing: [ OK ] 0.32 sec. 2026-03-19 05:48:56 02731_nothing_deserialization: [ OK ] 0.42 sec. 2026-03-19 05:48:57 02559_multiple_read_steps_in_prewhere_fuzz: [ OK ] 0.27 sec. 2026-03-19 05:48:57 01353_nullable_tuple: [ OK ] 0.72 sec. 2026-03-19 05:48:57 03001_backup_matview_after_modify_query: [ OK ] 2.98 sec. 2026-03-19 05:48:57 01880_remote_ipv6: [ OK ] 0.42 sec. 2026-03-19 05:48:57 03237_get_subcolumn_low_cardinality_column: [ OK ] 0.27 sec. 2026-03-19 05:48:57 02523_range_const_start: [ OK ] 0.27 sec. 2026-03-19 05:48:57 00136_duplicate_order_by_elems: [ OK ] 0.32 sec. 2026-03-19 05:48:57 01685_ssd_cache_dictionary_complex_key: [ OK ] 1.02 sec. 2026-03-19 05:48:57 03274_dynamic_column_data_race_with_concurrent_hj: [ OK ] 0.37 sec. 2026-03-19 05:48:57 01710_projection_row_policy: [ OK ] 0.32 sec. 2026-03-19 05:48:57 01913_fix_column_transformer_replace_format: [ OK ] 0.27 sec. 2026-03-19 05:48:57 03303_alias_inverse_order: [ OK ] 0.37 sec. 2026-03-19 05:48:57 01528_allow_nondeterministic_optimize_skip_unused_shards: [ OK ] 0.37 sec. 2026-03-19 05:48:58 01045_array_zip: [ OK ] 0.42 sec. 2026-03-19 05:48:58 00059_shard_global_in_mergetree: [ OK ] 0.42 sec. 2026-03-19 05:48:58 01390_remove_injective_in_uniq: [ OK ] 0.37 sec. 2026-03-19 05:48:58 00105_shard_collations: [ OK ] 0.52 sec. 2026-03-19 05:48:58 00620_optimize_on_nonleader_replica_zookeeper: [ OK ] 0.52 sec. 2026-03-19 05:48:58 02027_ngrams: [ OK ] 0.42 sec. 2026-03-19 05:48:58 02451_variadic_null_garbage_data: [ OK ] 0.37 sec. 2026-03-19 05:48:58 03034_dynamic_conversions: [ OK ] 0.47 sec. 2026-03-19 05:48:58 01802_formatDateTime_DateTime64_century: [ OK ] 0.32 sec. 2026-03-19 05:48:59 01414_low_cardinality_nullable: [ OK ] 1.67 sec. 2026-03-19 05:48:59 00901_joint_entropy: [ OK ] 0.37 sec. 2026-03-19 05:48:59 02473_extract_low_cardinality_from_json: [ OK ] 0.27 sec. 2026-03-19 05:48:59 01646_rewrite_sum_if: [ OK ] 0.67 sec. 2026-03-19 05:48:59 01147_partial_merge_full_join: [ OK ] 0.92 sec. 2026-03-19 05:48:59 02869_http_headers_elapsed_ns: [ OK ] 0.62 sec. 2026-03-19 05:48:59 01413_truncate_without_table_keyword: [ OK ] 0.32 sec. 2026-03-19 05:48:59 02988_join_using_prewhere_pushdown: [ OK ] 0.32 sec. 2026-03-19 05:49:00 00665_alter_nullable_string_to_nullable_uint8: [ OK ] 0.32 sec. 2026-03-19 05:49:00 00613_shard_distributed_max_execution_time: [ OK ] 0.27 sec. 2026-03-19 05:49:00 02226_low_cardinality_text_bloom_filter_index: [ OK ] 0.52 sec. 2026-03-19 05:49:00 00173_compare_date_time_with_constant_string: [ OK ] 0.42 sec. 2026-03-19 05:49:00 02489_analyzer_indexes: [ OK ] 0.42 sec. 2026-03-19 05:49:00 02809_has_token: [ OK ] 0.27 sec. 2026-03-19 05:49:00 01273_arrow_dictionaries_load: [ OK ] 4.38 sec. 2026-03-19 05:49:00 02111_global_context_temporary_tables: [ OK ] 0.32 sec. 2026-03-19 05:49:00 02526_kv_engine_different_filter_type: [ OK ] 0.37 sec. 2026-03-19 05:49:00 01523_interval_operator_support_string_literal: [ OK ] 0.32 sec. 2026-03-19 05:49:01 02176_optimize_aggregation_in_order_empty: [ OK ] 0.32 sec. 2026-03-19 05:49:01 00066_group_by_in: [ OK ] 0.27 sec. 2026-03-19 05:49:01 02841_not_ready_set_constraints: [ OK ] 0.37 sec. 2026-03-19 05:49:01 02008_test_union_distinct_in_subquery: [ OK ] 0.42 sec. 2026-03-19 05:49:01 02183_combinator_if: [ OK ] 0.67 sec. 2026-03-19 05:49:01 01135_default_and_alter_zookeeper: [ OK ] 0.32 sec. 2026-03-19 05:49:01 03023_invalid_format_detection: [ OK ] 0.82 sec. 2026-03-19 05:49:01 02551_ipv4_implicit_uint64: [ OK ] 0.32 sec. 2026-03-19 05:49:01 02352_grouby_shadows_arg: [ OK ] 0.32 sec. 2026-03-19 05:49:01 01523_client_local_queries_file_parameter: [ OK ] 1.82 sec. 2026-03-19 05:49:02 01053_drop_database_mat_view: [ OK ] 0.37 sec. 2026-03-19 05:49:02 00041_big_array_join: [ OK ] 0.47 sec. 2026-03-19 05:49:02 01690_quantilesTiming_ubsan: [ OK ] 0.37 sec. 2026-03-19 05:49:02 02366_kql_native_interval_format: [ OK ] 0.42 sec. 2026-03-19 05:49:02 02183_dictionary_date_types: [ OK ] 0.72 sec. 2026-03-19 05:49:02 01121_remote_scalar_subquery: [ OK ] 0.32 sec. 2026-03-19 05:49:02 01781_token_extractor_buffer_overflow: [ OK ] 0.52 sec. 2026-03-19 05:49:03 02886_binary_like: [ OK ] 0.42 sec. 2026-03-19 05:49:03 02032_short_circuit_least_greatest_bug: [ OK ] 0.69 sec. 2026-03-19 05:49:03 01277_large_tuples: [ OK ] 0.73 sec. 2026-03-19 05:49:04 00906_low_cardinality_rollup: [ OK ] 0.80 sec. 2026-03-19 05:49:04 02563_async_insert_bad_data: [ OK ] 2.28 sec. 2026-03-19 05:49:04 01049_join_low_card_crash: [ OK ] 0.94 sec. 2026-03-19 05:49:05 02810_async_insert_dedup_replicated_collapsing: [ OK ] 12.37 sec. 2026-03-19 05:49:05 02960_alter_table_part_query_parameter: [ OK ] 0.69 sec. 2026-03-19 05:49:05 02494_parser_string_binary_literal: [ OK ] 0.75 sec. 2026-03-19 05:49:05 02771_ignore_data_skipping_indices: [ OK ] 0.57 sec. 2026-03-19 05:49:06 00090_union_race_conditions_1: [ OK ] 10.83 sec. 2026-03-19 05:49:06 02734_optimize_group_by: [ OK ] 0.44 sec. 2026-03-19 05:49:06 01293_show_settings: [ OK ] 0.28 sec. 2026-03-19 05:49:06 00938_fix_rwlock_segfault_long: [ SKIPPED ] 0.00 sec. 2026-03-19 05:49:06 Reason: not running for current build 2026-03-19 05:49:06 03018_external_with_complex_data_types: [ OK ] 1.22 sec. 2026-03-19 05:49:06 01456_modify_column_type_via_add_drop_update: [ OK ] 0.98 sec. 2026-03-19 05:49:07 01801_s3_cluster_count: [ OK ] 0.49 sec. 2026-03-19 05:49:07 02426_pod_array_overflow_3: [ OK ] 0.58 sec. 2026-03-19 05:49:07 01067_join_null: [ OK ] 0.38 sec. 2026-03-19 05:49:07 00580_cast_nullable_to_non_nullable: [ OK ] 0.48 sec. 2026-03-19 05:49:07 02163_operators: [ OK ] 0.57 sec. 2026-03-19 05:49:08 02221_parallel_replicas_bug: [ OK ] 2.35 sec. 2026-03-19 05:49:08 01081_window_view_target_table_engine: [ OK ] 3.69 sec. 2026-03-19 05:49:08 03152_dynamic_type_simple: [ OK ] 0.58 sec. 2026-03-19 05:49:08 02708_dotProduct: [ OK ] 0.99 sec. 2026-03-19 05:49:08 01087_index_set_ubsan: [ OK ] 0.58 sec. 2026-03-19 05:49:08 00712_prewhere_with_alias: [ OK ] 0.99 sec. 2026-03-19 05:49:08 00434_tonullable: [ OK ] 0.39 sec. 2026-03-19 05:49:08 00931_low_cardinality_nullable_aggregate_function_type: [ OK ] 0.63 sec. 2026-03-19 05:49:09 03073_analyzer_alias_as_column_name: [ OK ] 0.59 sec. 2026-03-19 05:49:09 01043_dictionary_attribute_properties_values: [ OK ] 0.48 sec. 2026-03-19 05:49:09 02472_segfault_expression_parser: [ OK ] 0.45 sec. 2026-03-19 05:49:09 03162_dynamic_type_nested: [ OK ] 0.64 sec. 2026-03-19 05:49:09 03032_variant_bool_number_not_suspicious: [ OK ] 0.53 sec. 2026-03-19 05:49:10 02863_mutation_where_in_set_result_cache_pipeline_stuck_bug: [ OK ] 0.65 sec. 2026-03-19 05:49:10 02876_json_incomplete_types_as_strings_inference: [ OK ] 0.44 sec. 2026-03-19 05:49:10 00937_format_schema_rows_template: [ OK ] 4.10 sec. 2026-03-19 05:49:10 00674_has_array_enum: [ OK ] 0.69 sec. 2026-03-19 05:49:10 03227_dynamic_subcolumns_enumerate_streams: [ OK ] 0.59 sec. 2026-03-19 05:49:10 01518_cast_nullable_virtual_system_column: [ OK ] 0.45 sec. 2026-03-19 05:49:11 02792_drop_projection_lwd: [ OK ] 0.64 sec. 2026-03-19 05:49:11 01666_gcd_ubsan: [ OK ] 0.68 sec. 2026-03-19 05:49:11 02949_parallel_replicas_scalar_subquery_big_integer: [ OK ] 0.43 sec. 2026-03-19 05:49:11 01720_engine_file_empty_if_not_exists: [ OK ] 0.43 sec. 2026-03-19 05:49:12 02015_async_inserts_2: [ OK ] 1.89 sec. 2026-03-19 05:49:12 02845_arrayShiftRotate: [ OK ] 0.88 sec. 2026-03-19 05:49:12 03199_fix_auc_tie_handling: [ OK ] 0.53 sec. 2026-03-19 05:49:13 00999_nullable_nested_types_4877: [ OK ] 0.70 sec. 2026-03-19 05:49:13 00800_low_cardinality_empty_array: [ OK ] 0.63 sec. 2026-03-19 05:49:14 02815_logical_error_cannot_get_column_name_of_set: [ OK ] 0.54 sec. 2026-03-19 05:49:14 01529_bad_memory_tracking: [ OK ] 5.56 sec. 2026-03-19 05:49:14 01600_encode_XML: [ OK ] 0.45 sec. 2026-03-19 05:49:15 02988_ordinary_database_warning: [ OK ] 0.32 sec. 2026-03-19 05:49:15 03154_recursive_cte_distributed: [ OK ] 0.49 sec. 2026-03-19 05:49:15 02043_query_obfuscator_embedded_dictionaries: [ OK ] 1.19 sec. 2026-03-19 05:49:16 02233_with_total_empty_chunk: [ OK ] 0.37 sec. 2026-03-19 05:49:16 00939_limit_by_offset: [ OK ] 0.43 sec. 2026-03-19 05:49:16 01761_cast_to_enum_nullable: [ OK ] 0.48 sec. 2026-03-19 05:49:18 02751_protobuf_ipv6: [ OK ] 1.89 sec. 2026-03-19 05:49:18 02843_backup_use_same_s3_credentials_for_base_backup: [ OK ] 8.61 sec. 2026-03-19 05:49:20 02130_parse_quoted_null: [ OK ] 8.43 sec. 2026-03-19 05:49:20 02730_with_fill_by_sorting_prefix: [ OK ] 1.09 sec. 2026-03-19 05:49:20 02955_analyzer_using_functional_args: [ OK ] 2.13 sec. 2026-03-19 05:49:20 02146_mv_non_phys: [ OK ] 0.57 sec. 2026-03-19 05:49:20 01417_update_permutation_crash: [ OK ] 0.59 sec. 2026-03-19 05:49:20 02267_type_inference_for_insert_into_function_null: [ OK ] 0.44 sec. 2026-03-19 05:49:21 00197_if_fixed_string: [ OK ] 0.64 sec. 2026-03-19 05:49:21 01273_arrow_nested_arrays_load: [ OK ] 4.50 sec. 2026-03-19 05:49:21 02947_dropped_tables_parts: [ OK ] 0.88 sec. 2026-03-19 05:49:21 01825_type_json_ghdata_insert_select: [ OK ] 22.91 sec. 2026-03-19 05:49:22 01663_aes_msan: [ OK ] 0.44 sec. 2026-03-19 05:49:22 02734_sparse_columns_mutation: [ OK ] 0.57 sec. 2026-03-19 05:49:22 00938_dataset_test: [ OK ] 0.48 sec. 2026-03-19 05:49:22 02771_jit_functions_comparison_crash: [ OK ] 0.53 sec. 2026-03-19 05:49:22 00553_buff_exists_materlized_column: [ OK ] 0.49 sec. 2026-03-19 05:49:22 00169_join_constant_keys: [ OK ] 0.35 sec. 2026-03-19 05:49:23 01825_type_json_18: [ OK ] 0.59 sec. 2026-03-19 05:49:23 03048_not_found_column_xxx_in_block: [ OK ] 0.59 sec. 2026-03-19 05:49:23 02456_async_inserts_logs: [ OK ] 10.18 sec. 2026-03-19 05:49:23 01585_use_index_for_global_in: [ OK ] 0.57 sec. 2026-03-19 05:49:24 01655_quarter_modificator_for_formatDateTime: [ OK ] 0.49 sec. 2026-03-19 05:49:24 02841_parallel_replicas_summary: [ OK ] 3.35 sec. 2026-03-19 05:49:24 01024__getScalar: [ OK ] 0.53 sec. 2026-03-19 05:49:24 02475_analyzer_join_tree_subquery: [ OK ] 0.53 sec. 2026-03-19 05:49:25 00709_virtual_column_partition_id: [ OK ] 0.49 sec. 2026-03-19 05:49:25 00116_storage_set: [ OK ] 0.58 sec. 2026-03-19 05:49:26 02475_or_function_alias_and_const_where: [ OK ] 0.64 sec. 2026-03-19 05:49:27 02477_logical_expressions_optimizer_low_cardinality: [ OK ] 0.66 sec. 2026-03-19 05:49:27 00843_optimize_predicate_and_rename_table: [ OK ] 0.58 sec. 2026-03-19 05:49:28 01825_new_type_json_8: [ OK ] 5.47 sec. 2026-03-19 05:49:28 02499_escaped_quote_schema_inference: [ OK ] 0.49 sec. 2026-03-19 05:49:29 01582_distinct_subquery_groupby: [ OK ] 0.65 sec. 2026-03-19 05:49:29 01942_snowflakeIDToDateTime: [ OK ] 0.88 sec. 2026-03-19 05:49:29 01548_with_totals_having: [ OK ] 0.48 sec. 2026-03-19 05:49:29 02711_trim_aliases: [ OK ] 0.55 sec. 2026-03-19 05:49:30 02577_analyzer_array_join_calc_twice: [ OK ] 0.48 sec. 2026-03-19 05:49:30 02251_last_day_of_month: [ OK ] 0.49 sec. 2026-03-19 05:49:31 02813_func_now_and_alias: [ OK ] 0.53 sec. 2026-03-19 05:49:31 00609_prewhere_and_default: [ OK ] 0.88 sec. 2026-03-19 05:49:31 00936_crc_functions: [ OK ] 0.47 sec. 2026-03-19 05:49:31 02263_format_insert_settings: [ OK ] 6.31 sec. 2026-03-19 05:49:31 03246_json_tuple_decompress_race: [ OK ] 0.68 sec. 2026-03-19 05:49:32 01271_show_privileges: [ OK ] 0.45 sec. 2026-03-19 05:49:32 02122_join_group_by_timeout: [ OK ] 8.20 sec. 2026-03-19 05:49:32 01710_projection_in_set: [ OK ] 0.49 sec. 2026-03-19 05:49:32 03015_optimize_final_rmt: [ OK ] 9.11 sec. 2026-03-19 05:49:32 03040_array_sum_and_join: [ OK ] 0.43 sec. 2026-03-19 05:49:32 02461_cancel_finish_race: [ OK ] 30.51 sec. 2026-03-19 05:49:32 03151_pmj_join_non_procssed_clash: [ OK ] 0.63 sec. 2026-03-19 05:49:33 02383_schema_inference_hints: [ OK ] 0.27 sec. 2026-03-19 05:49:33 02723_param_exception_message_context: [ OK ] 1.38 sec. 2026-03-19 05:49:33 02187_test_final_and_limit_modifier: [ OK ] 0.27 sec. 2026-03-19 05:49:33 02317_distinct_in_order_optimization_explain: [ OK ] 22.56 sec. 2026-03-19 05:49:33 02427_mutate_and_zero_copy_replication_zookeeper: [ OK ] 0.37 sec. 2026-03-19 05:49:33 02162_array_first_last_index: [ OK ] 0.32 sec. 2026-03-19 05:49:33 01532_collate_in_low_cardinality: [ OK ] 0.37 sec. 2026-03-19 05:49:33 01123_parse_date_time_best_effort_even_more: [ OK ] 0.27 sec. 2026-03-19 05:49:33 00974_adaptive_granularity_secondary_index: [ OK ] 0.52 sec. 2026-03-19 05:49:33 03213_rand_dos: [ OK ] 0.32 sec. 2026-03-19 05:49:33 03262_analyzer_materialized_view_in_with_cte: [ OK ] 0.37 sec. 2026-03-19 05:49:33 01404_roundUpToPowerOfTwoOrZero_safety: [ OK ] 0.32 sec. 2026-03-19 05:49:33 00685_output_format_json_escape_forward_slashes: [ OK ] 0.27 sec. 2026-03-19 05:49:34 01504_rocksdb: [ OK ] 1.88 sec. 2026-03-19 05:49:34 01502_jemalloc_percpu_arena: [ SKIPPED ] 0.00 sec. 2026-03-19 05:49:34 Reason: not running for current build 2026-03-19 05:49:34 02353_compression_level: [ OK ] 12.69 sec. 2026-03-19 05:49:34 02517_infer_uint64_in_case_of_int64_overflow: [ OK ] 1.97 sec. 2026-03-19 05:49:34 02908_table_ttl_dependency: [ OK ] 1.17 sec. 2026-03-19 05:49:34 00605_intersections_aggregate_functions: [ OK ] 0.27 sec. 2026-03-19 05:49:34 00550_join_insert_select: [ OK ] 1.07 sec. 2026-03-19 05:49:35 02353_isnullable: [ OK ] 0.27 sec. 2026-03-19 05:49:35 02867_null_lc_in_bug: [ OK ] 0.32 sec. 2026-03-19 05:49:35 02935_ipv6_bit_operations: [ OK ] 0.27 sec. 2026-03-19 05:49:35 02995_bad_formatting_union_intersect: [ OK ] 0.27 sec. 2026-03-19 05:49:35 01620_fix_simple_state_arg_type: [ OK ] 0.37 sec. 2026-03-19 05:49:35 02013_json_function_null_column: [ OK ] 0.52 sec. 2026-03-19 05:49:35 00952_insert_into_distributed_with_materialized_column: [ OK ] 0.52 sec. 2026-03-19 05:49:36 01559_aggregate_null_for_empty_fix: [ OK ] 0.37 sec. 2026-03-19 05:49:36 00453_cast_enum: [ OK ] 0.42 sec. 2026-03-19 05:49:36 02474_fix_function_parser_bug: [ OK ] 0.22 sec. 2026-03-19 05:49:36 02968_full_sorting_join_fuzz: [ OK ] 1.88 sec. 2026-03-19 05:49:36 01471_with_format: [ OK ] 0.27 sec. 2026-03-19 05:49:36 01849_geoToS2: [ OK ] 0.47 sec. 2026-03-19 05:49:36 00085_visible_width_of_tuple_of_dates: [ OK ] 0.32 sec. 2026-03-19 05:49:36 02009_body_query_params: [ OK ] 0.52 sec. 2026-03-19 05:49:36 03037_dynamic_merges_2_vertical_compact_merge_tree: [ OK ] 0.57 sec. 2026-03-19 05:49:37 00484_preferred_max_column_in_block_size_bytes: [ OK ] 0.82 sec. 2026-03-19 05:49:37 01550_type_map_formats_input: [ OK ] 3.83 sec. 2026-03-19 05:49:37 02354_tuple_element_with_default: [ OK ] 0.32 sec. 2026-03-19 05:49:37 03005_input_function_in_join: [ OK ] 0.32 sec. 2026-03-19 05:49:37 02888_obsolete_settings: [ OK ] 0.32 sec. 2026-03-19 05:49:37 02481_analyzer_optimize_grouping_sets_keys: [ OK ] 0.32 sec. 2026-03-19 05:49:37 00164_not_chain: [ OK ] 0.37 sec. 2026-03-19 05:49:37 02345_filesystem_local: [ OK ] 0.73 sec. 2026-03-19 05:49:37 01139_asof_join_types: [ OK ] 0.37 sec. 2026-03-19 05:49:38 03069_analyzer_with_alias_in_array_join: [ OK ] 0.32 sec. 2026-03-19 05:49:38 03208_array_of_json_read_subcolumns_2_memory: [ SKIPPED ] 0.00 sec. 2026-03-19 05:49:38 Reason: not running for current build 2026-03-19 05:49:38 00961_check_table: [ OK ] 0.42 sec. 2026-03-19 05:49:38 03680_loop_table_function_access_check: [ OK ] 1.77 sec. 2026-03-19 05:49:38 02841_tuple_modulo: [ OK ] 0.32 sec. 2026-03-19 05:49:38 00875_join_right_nulls: [ OK ] 0.47 sec. 2026-03-19 05:49:39 01607_arrays_as_nested_csv: [ OK ] 1.98 sec. 2026-03-19 05:49:39 00075_shard_formatting_negate_of_negative_literal: [ OK ] 0.32 sec. 2026-03-19 05:49:39 02879_use_structure_from_insertion_table_with_defaults: [ OK ] 0.87 sec. 2026-03-19 05:49:39 01474_decimal_scale_bug: [ OK ] 0.32 sec. 2026-03-19 05:49:39 00313_const_totals_extremes: [ OK ] 0.63 sec. 2026-03-19 05:49:40 02998_http_redirects: [ OK ] 0.52 sec. 2026-03-19 05:49:40 02122_parallel_formatting_CustomSeparated: [ OK ] 2.12 sec. 2026-03-19 05:49:40 02344_analyzer_multiple_aliases_for_expression: [ OK ] 0.37 sec. 2026-03-19 05:49:40 01825_type_json_from_map: [ OK ] 2.12 sec. 2026-03-19 05:49:40 03008_deduplication_wrong_mv: [ OK ] 0.32 sec. 2026-03-19 05:49:40 02481_analyzer_optimize_aggregation_arithmetics: [ OK ] 0.47 sec. 2026-03-19 05:49:40 02269_to_start_of_interval_overflow: [ OK ] 0.27 sec. 2026-03-19 05:49:40 02479_analyzer_aggregation_crash: [ OK ] 0.27 sec. 2026-03-19 05:49:40 02243_ipv6_long_parsing: [ OK ] 0.27 sec. 2026-03-19 05:49:40 03165_distinct_with_window_func_crash: [ OK ] 0.32 sec. 2026-03-19 05:49:40 00534_exp10: [ OK ] 0.27 sec. 2026-03-19 05:49:40 01101_literal_column_clash: [ OK ] 0.32 sec. 2026-03-19 05:49:41 02890_untuple_column_names: [ OK ] 0.47 sec. 2026-03-19 05:49:41 01851_hedged_connections_external_tables: [ OK ] 0.32 sec. 2026-03-19 05:49:41 03093_special_column_errors: [ OK ] 0.57 sec. 2026-03-19 05:49:41 02224_parallel_distributed_insert_select_cluster: [ OK ] 0.42 sec. 2026-03-19 05:49:41 02477_s3_request_throttler: [ OK ] 2.17 sec. 2026-03-19 05:49:41 01851_clear_column_referenced_by_mv: [ OK ] 0.32 sec. 2026-03-19 05:49:41 00952_part_frozen_info: [ OK ] 0.47 sec. 2026-03-19 05:49:42 02999_ulid_short_circuit: [ OK ] 0.37 sec. 2026-03-19 05:49:42 01071_force_optimize_skip_unused_shards: [ OK ] 0.42 sec. 2026-03-19 05:49:42 01272_suspicious_codecs: [ OK ] 0.67 sec. 2026-03-19 05:49:43 03003_database_filesystem_format_detection: [ OK ] 1.72 sec. 2026-03-19 05:49:43 02661_read_from_archive_tar: [ OK ] 9.34 sec. 2026-03-19 05:49:43 01632_nullable_string_type_convert_to_decimal_type: [ OK ] 0.32 sec. 2026-03-19 05:49:44 02476_fix_lambda_parsing: [ OK ] 0.67 sec. 2026-03-19 05:49:44 02122_parallel_formatting_Vertical: [ OK ] 2.53 sec. 2026-03-19 05:49:44 02864_restore_table_with_broken_part: [ OK ] 1.98 sec. 2026-03-19 05:49:44 03173_check_cyclic_dependencies_on_create_and_rename: [ OK ] 0.42 sec. 2026-03-19 05:49:44 03002_map_array_functions_with_low_cardinality: [ OK ] 0.32 sec. 2026-03-19 05:49:44 00825_protobuf_format_nested_in_nested: [ OK ] 1.87 sec. 2026-03-19 05:49:44 00346_if_tuple: [ OK ] 0.37 sec. 2026-03-19 05:49:44 01893_jit_aggregation_function_min_long: [ OK ] 1.42 sec. 2026-03-19 05:49:44 02766_bitshift_with_const_arguments: [ OK ] 0.43 sec. 2026-03-19 05:49:45 00661_optimize_final_replicated_without_partition_zookeeper: [ OK ] 0.52 sec. 2026-03-19 05:49:45 03321_functions_to_subcolumns_skip_index: [ OK ] 0.37 sec. 2026-03-19 05:49:45 02204_fractional_progress_bar_long: [ SKIPPED ] 0.00 sec. 2026-03-19 05:49:45 Reason: not running for current build 2026-03-19 05:49:45 01353_low_cardinality_join_types: [ OK ] 0.57 sec. 2026-03-19 05:49:45 01283_max_threads_simple_query_optimization: [ OK ] 0.52 sec. 2026-03-19 05:49:45 02293_h3_line: [ OK ] 0.37 sec. 2026-03-19 05:49:45 00905_compile_expressions_compare_big_dates: [ OK ] 0.37 sec. 2026-03-19 05:49:45 02713_sequence_match_serialization_fix: [ OK ] 0.42 sec. 2026-03-19 05:49:46 02344_distinct_limit_distiributed: [ OK ] 0.88 sec. 2026-03-19 05:49:46 02491_part_log_has_table_uuid: [ OK ] 0.62 sec. 2026-03-19 05:49:46 01710_normal_projection_with_query_plan_optimization: [ OK ] 0.37 sec. 2026-03-19 05:49:46 01355_CSV_input_format_allow_errors: [ OK ] 1.93 sec. 2026-03-19 05:49:46 02864_statistics_ddl: [ OK ] 1.32 sec. 2026-03-19 05:49:47 02982_comments_in_system_tables: [ OK ] 0.92 sec. 2026-03-19 05:49:47 02294_optimize_aggregation_in_order_prefix_Array_functions: [ OK ] 0.27 sec. 2026-03-19 05:49:47 02476_analyzer_identifier_hints: [ OK ] 13.76 sec. 2026-03-19 05:49:47 00947_ml_test: [ OK ] 0.47 sec. 2026-03-19 05:49:47 01825_type_json_16: [ OK ] 2.28 sec. 2026-03-19 05:49:47 00534_functions_bad_arguments1: [ SKIPPED ] 0.00 sec. 2026-03-19 05:49:47 Reason: not running for current build 2026-03-19 05:49:47 02995_index_6: [ SKIPPED ] 0.00 sec. 2026-03-19 05:49:47 Reason: not running for current build 2026-03-19 05:49:48 02377_optimize_sorting_by_input_stream_properties: [ OK ] 0.42 sec. 2026-03-19 05:49:48 01122_totals_rollup_having_block_header: [ OK ] 0.42 sec. 2026-03-19 05:49:48 02973_analyzer_join_use_nulls_column_not_found: [ OK ] 0.37 sec. 2026-03-19 05:49:48 01825_type_json_7: [ OK ] 1.92 sec. 2026-03-19 05:49:48 03204_format_join_on: [ OK ] 0.72 sec. 2026-03-19 05:49:49 02423_ddl_for_opentelemetry: [ OK ] 7.74 sec. 2026-03-19 05:49:49 00720_with_cube: [ OK ] 0.32 sec. 2026-03-19 05:49:49 01581_deduplicate_by_columns_local: [ OK ] 0.78 sec. 2026-03-19 05:49:49 02201_use_skip_indexes_if_final: [ OK ] 0.37 sec. 2026-03-19 05:49:49 01090_fixed_string_bit_ops: [ OK ] 0.27 sec. 2026-03-19 05:49:49 00065_shard_float_literals_formatting: [ OK ] 0.27 sec. 2026-03-19 05:49:49 03217_primary_index_memory_leak: [ SKIPPED ] 0.00 sec. 2026-03-19 05:49:49 Reason: not running for current build 2026-03-19 05:49:50 01923_ttl_with_modify_column: [ OK ] 0.47 sec. 2026-03-19 05:49:50 00396_uuid: [ OK ] 0.32 sec. 2026-03-19 05:49:50 02764_csv_trim_whitespaces: [ OK ] 15.46 sec. 2026-03-19 05:49:50 03010_read_system_parts_table_test: [ OK ] 0.32 sec. 2026-03-19 05:49:50 02588_avro_date32_and_decimals: [ OK ] 1.32 sec. 2026-03-19 05:49:50 02429_low_cardinality_trash: [ OK ] 0.62 sec. 2026-03-19 05:49:50 03064_analyzer_named_subqueries: [ OK ] 0.27 sec. 2026-03-19 05:49:50 00073_merge_sorting_empty_array_joined: [ OK ] 0.27 sec. 2026-03-19 05:49:50 02902_topKGeneric_deserialization_memory: [ OK ] 0.32 sec. 2026-03-19 05:49:51 01071_window_view_event_tumble_asc_join: [ OK ] 2.68 sec. 2026-03-19 05:49:51 00725_join_on_bug_1: [ OK ] 0.32 sec. 2026-03-19 05:49:51 01287_max_execution_speed: [ OK ] 4.43 sec. 2026-03-19 05:49:51 01596_setting_limit_offset: [ OK ] 0.37 sec. 2026-03-19 05:49:51 02383_arrow_dict_special_cases: [ OK ] 3.48 sec. 2026-03-19 05:49:51 02842_largestTriangleThreeBuckets_aggregate_function: [ OK ] 0.47 sec. 2026-03-19 05:49:51 02950_parallel_replicas_used_count: [ OK ] 0.97 sec. 2026-03-19 05:49:51 02889_print_pretty_type_names: [ OK ] 0.32 sec. 2026-03-19 05:49:51 02493_max_streams_for_merge_tree_reading: [ OK ] 1.42 sec. 2026-03-19 05:49:51 01414_freeze_does_not_prevent_alters: [ OK ] 0.42 sec. 2026-03-19 05:49:51 00969_columns_clause: [ OK ] 0.32 sec. 2026-03-19 05:49:51 00114_float_type_result_of_division: [ OK ] 0.27 sec. 2026-03-19 05:49:52 00687_insert_into_mv: [ OK ] 0.37 sec. 2026-03-19 05:49:52 02814_ReplacingMergeTree_fix_select_final_on_single_partition: [ OK ] 0.37 sec. 2026-03-19 05:49:52 02910_bad_logs_level_in_local: [ OK ] 0.22 sec. 2026-03-19 05:49:52 02971_analyzer_remote_id: [ OK ] 0.92 sec. 2026-03-19 05:49:52 01528_setting_aggregate_functions_null_for_empty: [ OK ] 0.37 sec. 2026-03-19 05:49:52 01785_pmj_lc_bug: [ OK ] 0.32 sec. 2026-03-19 05:49:52 03164_early_constant_folding_analyzer: [ OK ] 0.32 sec. 2026-03-19 05:49:52 00834_limit_with_constant_expressions: [ OK ] 0.42 sec. 2026-03-19 05:49:52 01835_alias_to_primary_key_cyfdecyf: [ OK ] 0.32 sec. 2026-03-19 05:49:52 00932_array_intersect_bug: [ OK ] 0.32 sec. 2026-03-19 05:49:52 02770_jit_aggregation_nullable_key_fix: [ OK ] 0.52 sec. 2026-03-19 05:49:52 00266_read_overflow_mode: [ OK ] 0.37 sec. 2026-03-19 05:49:52 02015_async_inserts_7: [ OK ] 5.74 sec. 2026-03-19 05:49:52 02466_distributed_query_profiler: [ OK ] 1.17 sec. 2026-03-19 05:49:52 01906_partition_by_multiply_by_zero: [ OK ] 0.37 sec. 2026-03-19 05:49:53 00050_any_left_join: [ OK ] 0.27 sec. 2026-03-19 05:49:53 03113_analyzer_not_found_column_in_block_2: [ OK ] 0.32 sec. 2026-03-19 05:49:53 00523_aggregate_functions_in_group_array: [ OK ] 0.32 sec. 2026-03-19 05:49:53 02725_object_column_alter: [ OK ] 0.32 sec. 2026-03-19 05:49:53 02734_sparse_columns_short_circuit: [ OK ] 0.42 sec. 2026-03-19 05:49:54 02908_Npy_files_caching: [ OK ] 1.57 sec. 2026-03-19 05:49:54 00940_order_by_read_in_order_query_plan: [ OK ] 1.22 sec. 2026-03-19 05:49:54 02158_proportions_ztest_cmp: [ OK ] 1.48 sec. 2026-03-19 05:49:54 00753_alter_attach: [ OK ] 1.08 sec. 2026-03-19 05:49:54 00293_shard_max_subquery_depth: [ OK ] 0.37 sec. 2026-03-19 05:49:54 02923_join_use_nulls_modulo: [ OK ] 0.37 sec. 2026-03-19 05:49:54 03034_recursive_cte_tree_fuzz_crash_fix: [ OK ] 0.47 sec. 2026-03-19 05:49:54 03208_array_of_json_read_subcolumns_1: [ OK ] 3.48 sec. 2026-03-19 05:49:54 01301_polygons_within: [ OK ] 0.37 sec. 2026-03-19 05:49:55 02343_aggregation_pipeline: [ OK ] 0.47 sec. 2026-03-19 05:49:55 01445_create_table_as_table_function: [ OK ] 1.37 sec. 2026-03-19 05:49:55 01781_merge_tree_deduplication: [ OK ] 0.92 sec. 2026-03-19 05:49:55 02789_functions_after_sorting_and_columns_with_same_names_bug_2: [ OK ] 0.37 sec. 2026-03-19 05:49:55 01356_state_resample: [ OK ] 0.32 sec. 2026-03-19 05:49:55 03130_convert_outer_join_to_inner_join: [ OK ] 0.42 sec. 2026-03-19 05:49:55 03032_numbers_zeros: [ OK ] 0.37 sec. 2026-03-19 05:49:55 02265_column_ttl: [ OK ] 0.57 sec. 2026-03-19 05:49:55 00679_replace_asterisk: [ OK ] 0.33 sec. 2026-03-19 05:49:55 00271_agg_state_and_totals: [ OK ] 0.27 sec. 2026-03-19 05:49:55 02559_multiple_read_steps_in_prewhere_missing_columns_2: [ OK ] 0.32 sec. 2026-03-19 05:49:56 00591_columns_removal_union_all: [ OK ] 0.32 sec. 2026-03-19 05:49:56 01549_low_cardinality_mv_fuzz: [ OK ] 0.37 sec. 2026-03-19 05:49:56 01947_mv_subquery: [ OK ] 0.72 sec. 2026-03-19 05:49:56 00957_delta_diff_bug: [ OK ] 0.32 sec. 2026-03-19 05:49:56 00104_totals_having_mode: [ OK ] 0.37 sec. 2026-03-19 05:49:56 00559_filter_array_generic: [ OK ] 0.27 sec. 2026-03-19 05:49:56 00402_nan_and_extremes: [ OK ] 0.32 sec. 2026-03-19 05:49:56 01825_new_type_json_parallel_insert: [ OK ] 0.37 sec. 2026-03-19 05:49:56 02481_pk_analysis_with_enum_to_string: [ OK ] 0.42 sec. 2026-03-19 05:49:57 00441_nulls_in: [ OK ] 0.42 sec. 2026-03-19 05:49:57 02556_local_with_totals_and_extremes: [ OK ] 0.77 sec. 2026-03-19 05:49:57 01412_group_array_moving_shard: [ OK ] 0.52 sec. 2026-03-19 05:49:57 01710_projections_partial_optimize_aggregation_in_order: [ OK ] 4.78 sec. 2026-03-19 05:49:57 03003_functions_to_subcolumns_final: [ OK ] 0.47 sec. 2026-03-19 05:49:57 01031_pmj_new_any_semi_join: [ OK ] 0.47 sec. 2026-03-19 05:49:57 02570_fallback_from_async_insert: [ OK ] 2.53 sec. 2026-03-19 05:49:57 01547_query_log_current_database: [ OK ] 0.47 sec. 2026-03-19 05:49:58 02713_ip4_uint_compare: [ OK ] 0.37 sec. 2026-03-19 05:49:58 00926_zookeeper_adaptive_index_granularity_replicated_merge_tree_long: [ OK ] 3.18 sec. 2026-03-19 05:49:58 02042_map_get_non_const_key: [ OK ] 0.33 sec. 2026-03-19 05:49:58 01083_match_zero_byte: [ OK ] 0.37 sec. 2026-03-19 05:49:58 02814_create_index_uniq_noop: [ OK ] 0.32 sec. 2026-03-19 05:49:58 02741_hashed_dictionary_load_factor: [ OK ] 0.97 sec. 2026-03-19 05:49:59 01037_zookeeper_check_table_empty_pk: [ OK ] 0.37 sec. 2026-03-19 05:49:59 02354_read_in_order_prewhere: [ OK ] 1.02 sec. 2026-03-19 05:49:59 01430_modify_sample_by_zookeeper_long: [ OK ] 1.02 sec. 2026-03-19 05:49:59 01650_fetch_patition_with_macro_in_zk_path_long: [ OK ] 0.42 sec. 2026-03-19 05:49:59 02006_todatetime64_from_string: [ OK ] 0.27 sec. 2026-03-19 05:49:59 01932_global_in_function: [ OK ] 0.32 sec. 2026-03-19 05:49:59 02340_analyzer_functions: [ OK ] 0.32 sec. 2026-03-19 05:49:59 00695_pretty_max_column_pad_width: [ OK ] 0.27 sec. 2026-03-19 05:50:00 01196_max_parser_depth: [ OK ] 0.97 sec. 2026-03-19 05:50:00 02493_numeric_literals_with_underscores: [ OK ] 0.77 sec. 2026-03-19 05:50:00 00700_decimal_aggregates: [ OK ] 0.87 sec. 2026-03-19 05:50:00 02097_initializeAggregationNullable: [ OK ] 0.27 sec. 2026-03-19 05:50:00 00252_shard_global_in_aggregate_function: [ OK ] 0.32 sec. 2026-03-19 05:50:00 02890_partition_prune_in_extra_columns: [ OK ] 0.32 sec. 2026-03-19 05:50:01 03203_fill_missed_subcolumns: [ OK ] 0.42 sec. 2026-03-19 05:50:01 03148_setting_max_streams_to_max_threads_ratio_overflow: [ OK ] 0.32 sec. 2026-03-19 05:50:01 02122_parallel_formatting_PrettyCompactNoEscapes: [ OK ] 3.33 sec. 2026-03-19 05:50:01 02115_write_buffers_finalize: [ OK ] 7.74 sec. 2026-03-19 05:50:01 02962_analyzer_constant_set: [ OK ] 0.32 sec. 2026-03-19 05:50:01 01493_table_function_null: [ OK ] 0.32 sec. 2026-03-19 05:50:01 01323_if_with_nulls: [ OK ] 0.47 sec. 2026-03-19 05:50:01 00809_add_days_segfault: [ OK ] 0.32 sec. 2026-03-19 05:50:02 03092_analyzer_same_table_name_in_different_databases: [ OK ] 0.32 sec. 2026-03-19 05:50:02 01710_projection_with_nullable_keys: [ OK ] 0.22 sec. 2026-03-19 05:50:02 00064_negate_bug: [ OK ] 0.27 sec. 2026-03-19 05:50:02 02293_h3_hex_ring: [ OK ] 0.42 sec. 2026-03-19 05:50:02 00048_b_stored_aggregates_merge: [ OK ] 0.42 sec. 2026-03-19 05:50:02 02149_schema_inference_formats_with_schema_3: [ OK ] 2.58 sec. 2026-03-19 05:50:02 01272_totals_and_filter_bug: [ OK ] 0.47 sec. 2026-03-19 05:50:03 00500_point_in_polygon: [ OK ] 0.62 sec. 2026-03-19 05:50:03 01213_alter_rename_nested: [ OK ] 0.47 sec. 2026-03-19 05:50:03 01668_avg_weighted_ubsan: [ OK ] 0.32 sec. 2026-03-19 05:50:03 02296_nullable_arguments_in_array_filter: [ OK ] 0.33 sec. 2026-03-19 05:50:04 02697_stop_reading_on_first_cancel: [ OK ] 1.08 sec. 2026-03-19 05:50:04 02229_client_stop_multiquery_in_SIGINT: [ OK ] 7.94 sec. 2026-03-19 05:50:04 02071_lower_upper_utf8_row_overlaps: [ OK ] 0.37 sec. 2026-03-19 05:50:04 03107_ill_formed_select_in_materialized_view: [ OK ] 0.33 sec. 2026-03-19 05:50:04 00746_compile_non_deterministic_function: [ OK ] 6.39 sec. 2026-03-19 05:50:04 01073_crlf_end_of_line: [ OK ] 0.33 sec. 2026-03-19 05:50:04 02267_insert_empty_data: [ OK ] 0.27 sec. 2026-03-19 05:50:04 03033_tupleIntXYZ_and_tupleModulo: [ OK ] 0.57 sec. 2026-03-19 05:50:04 01825_new_type_json_add_column: [ OK ] 0.47 sec. 2026-03-19 05:50:05 00623_truncate_table: [ OK ] 0.67 sec. 2026-03-19 05:50:06 00981_no_virtual_columns: [ OK ] 0.42 sec. 2026-03-19 05:50:06 01881_join_on_conditions_hash: [ OK ] 1.43 sec. 2026-03-19 05:50:06 02841_parallel_final_wrong_columns_order: [ OK ] 1.58 sec. 2026-03-19 05:50:06 00545_weird_aggregate_functions: [ OK ] 0.32 sec. 2026-03-19 05:50:06 00165_transform_non_const_default: [ OK ] 0.43 sec. 2026-03-19 05:50:06 02883_array_scalar_mult_div_modulo: [ OK ] 0.58 sec. 2026-03-19 05:50:07 00753_quantile_format: [ OK ] 0.54 sec. 2026-03-19 05:50:07 03001_block_offset_column_2: [ OK ] 0.42 sec. 2026-03-19 05:50:07 02280_add_query_level_settings: [ OK ] 0.37 sec. 2026-03-19 05:50:08 02935_http_content_type_with_http_headers_progress: [ OK ] 5.89 sec. 2026-03-19 05:50:08 01720_country_perimeter_and_area: [ OK ] 4.69 sec. 2026-03-19 05:50:08 02381_parse_array_of_tuples: [ OK ] 0.32 sec. 2026-03-19 05:50:08 02458_empty_hdfs_url: [ OK ] 0.33 sec. 2026-03-19 05:50:08 00558_parse_floats: [ OK ] 0.33 sec. 2026-03-19 05:50:08 02500_bson_read_object_id: [ OK ] 0.82 sec. 2026-03-19 05:50:09 00833_sleep_overflow: [ OK ] 0.27 sec. 2026-03-19 05:50:09 01747_alter_partition_key_enum_zookeeper_long: [ OK ] 0.62 sec. 2026-03-19 05:50:09 02366_kql_tabular: [ OK ] 0.62 sec. 2026-03-19 05:50:09 02801_backup_native_copy: [ OK ] 4.89 sec. 2026-03-19 05:50:09 02661_read_from_archive_tzst: [ OK ] 9.95 sec. 2026-03-19 05:50:09 02227_union_match_by_name: [ OK ] 0.37 sec. 2026-03-19 05:50:09 02011_tuple_vector_functions: [ OK ] 0.82 sec. 2026-03-19 05:50:10 02949_parallel_replicas_in_subquery: [ OK ] 0.52 sec. 2026-03-19 05:50:10 02306_rowbinary_has_no_bom: [ OK ] 0.57 sec. 2026-03-19 05:50:10 02904_empty_order_by_with_setting_enabled: [ OK ] 1.42 sec. 2026-03-19 05:50:10 01480_binary_operator_monotonicity: [ OK ] 0.57 sec. 2026-03-19 05:50:11 01498_alter_column_storage_memory: [ OK ] 0.37 sec. 2026-03-19 05:50:11 03001_bad_error_message_higher_order_functions: [ OK ] 0.92 sec. 2026-03-19 05:50:12 01600_quota_by_forwarded_ip: [ OK ] 1.22 sec. 2026-03-19 05:50:12 02444_async_broken_outdated_part_loading: [ OK ] 5.29 sec. 2026-03-19 05:50:12 02968_url_args: [ OK ] 0.27 sec. 2026-03-19 05:50:12 02025_nested_func_for_if_combinator: [ OK ] 0.32 sec. 2026-03-19 05:50:12 00514_interval_operators: [ OK ] 0.47 sec. 2026-03-19 05:50:12 02482_execute_functions_before_sorting_bug: [ OK ] 0.27 sec. 2026-03-19 05:50:13 00022_func_higher_order_and_constants: [ OK ] 0.37 sec. 2026-03-19 05:50:13 02125_fix_storage_filelog: [ OK ] 0.27 sec. 2026-03-19 05:50:13 01049_join_low_card_bug_long: [ OK ] 4.13 sec. 2026-03-19 05:50:13 03120_analyzer_param_in_CTE_alias: [ OK ] 0.32 sec. 2026-03-19 05:50:13 01762_deltasumtimestamp: [ OK ] 0.37 sec. 2026-03-19 05:50:14 00215_primary_key_order_zookeeper_long: [ OK ] 0.52 sec. 2026-03-19 05:50:14 01780_column_sparse_tuple: [ OK ] 0.52 sec. 2026-03-19 05:50:14 01676_range_hashed_dictionary: [ OK ] 0.57 sec. 2026-03-19 05:50:14 02149_schema_inference_create_table_syntax: [ OK ] 4.98 sec. 2026-03-19 05:50:15 01358_constexpr_constraint: [ OK ] 0.32 sec. 2026-03-19 05:50:15 02461_mullable_pk_monotonicity_bug: [ OK ] 0.57 sec. 2026-03-19 05:50:15 02497_having_without_actual_aggregation_bug: [ OK ] 0.32 sec. 2026-03-19 05:50:15 03096_largest_triangle_3b_crash: [ OK ] 0.27 sec. 2026-03-19 05:50:15 02142_http_with_query_parameters: [ OK ] 0.57 sec. 2026-03-19 05:50:16 02267_join_dup_columns_issue36199: [ OK ] 0.47 sec. 2026-03-19 05:50:16 00373_group_by_tuple: [ OK ] 0.37 sec. 2026-03-19 05:50:16 00856_no_column_issue_4242: [ OK ] 0.39 sec. 2026-03-19 05:50:16 02311_create_table_with_unknown_format: [ OK ] 0.42 sec. 2026-03-19 05:50:17 02764_parallel_replicas_plain_merge_tree: [ OK ] 0.43 sec. 2026-03-19 05:50:17 00172_constexprs_in_set: [ OK ] 0.37 sec. 2026-03-19 05:50:17 02969_functions_to_subcolumns_if_null: [ OK ] 0.37 sec. 2026-03-19 05:50:18 02967_parallel_replicas_join_algo_and_analyzer_2: [ OK ] 3.99 sec. 2026-03-19 05:50:18 01273_arrow: [ OK ] 17.28 sec. 2026-03-19 05:50:18 01062_pm_multiple_all_join_same_value: [ OK ] 0.32 sec. 2026-03-19 05:50:18 01413_alter_update_supertype: [ OK ] 0.42 sec. 2026-03-19 05:50:18 02900_buffer_table_alter_race: [ OK ] 8.34 sec. 2026-03-19 05:50:19 02160_h3_cell_area_m2: [ OK ] 0.32 sec. 2026-03-19 05:50:19 00875_join_right_nulls_ors: [ OK ] 0.47 sec. 2026-03-19 05:50:19 03209_json_type_merges_small: [ SKIPPED ] 0.00 sec. 2026-03-19 05:50:19 Reason: not running for current build 2026-03-19 05:50:19 00177_inserts_through_http_parts: [ OK ] 0.62 sec. 2026-03-19 05:50:19 03033_analyzer_resolve_from_parent_scope: [ OK ] 0.47 sec. 2026-03-19 05:50:19 02113_format_row: [ OK ] 0.27 sec. 2026-03-19 05:50:20 02122_parallel_formatting_JSONEachRow: [ OK ] 2.23 sec. 2026-03-19 05:50:20 00933_alter_ttl: [ OK ] 0.37 sec. 2026-03-19 05:50:20 01825_new_type_json_11: [ OK ] 3.74 sec. 2026-03-19 05:50:20 02343_group_by_use_nulls: [ OK ] 0.42 sec. 2026-03-19 05:50:20 00927_disable_hyperscan: [ OK ] 0.47 sec. 2026-03-19 05:50:20 02174_cte_scalar_cache: [ OK ] 0.57 sec. 2026-03-19 05:50:21 02893_bad_sample_view: [ OK ] 0.32 sec. 2026-03-19 05:50:21 01076_range_reader_segfault: [ OK ] 0.32 sec. 2026-03-19 05:50:21 03206_no_exceptions_clickhouse_local: [ FAIL ] 0.68 sec. 2026-03-19 05:50:21 Reason: return code: 134, result: 2026-03-19 05:50:21 2026-03-19 05:50:21 2026-03-19 05:50:21 2026-03-19 05:50:21 stdout: 2026-03-19 05:50:21 2026-03-19 05:50:21 2026-03-19 05:50:21 Settings used in the test: --max_insert_threads 2 --group_by_two_level_threshold 593103 --group_by_two_level_threshold_bytes 15435501 --distributed_aggregation_memory_efficient 1 --fsync_metadata 0 --output_format_parallel_formatting 0 --input_format_parallel_parsing 0 --min_chunk_bytes_for_parallel_parsing 12731991 --max_read_buffer_size 1023603 --prefer_localhost_replica 1 --max_block_size 77468 --max_joined_block_size_rows 45036 --max_threads 3 --optimize_append_index 0 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 1 --optimize_read_in_order 1 --optimize_or_like_chain 1 --optimize_substitute_columns 0 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 75 --optimize_aggregation_in_order 0 --aggregation_in_order_max_block_bytes 5270566 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 1 --min_bytes_to_use_mmap_io 4748860142 --local_filesystem_read_method io_uring --remote_filesystem_read_method read --local_filesystem_read_prefetch 1 --filesystem_cache_segments_batch_size 50 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 1 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 128Mi --filesystem_prefetches_limit 0 --filesystem_prefetch_min_bytes_for_single_read_task 8Mi --filesystem_prefetch_step_marks 0 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 0 --compile_sort_description 1 --merge_tree_coarse_index_granularity 5 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 10737418240 --max_bytes_before_external_group_by 10737418240 --max_bytes_before_remerge_sort 1008001571 --min_compress_block_size 638457 --max_compress_block_size 1781123 --merge_tree_compact_parts_min_granules_to_multibuffer_read 44 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 3736436 --http_wait_end_of_query True --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 3 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 0 --session_timezone Africa/Juba --use_page_cache_for_disks_without_file_cache False --page_cache_inject_eviction False --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.45 --prefer_external_sort_block_bytes 100000000 --cross_join_min_rows_to_compress 0 --cross_join_min_bytes_to_compress 0 --min_external_table_block_size_bytes 1 --max_parsing_threads 1 --optimize_functions_to_subcolumns 1 --parallel_replicas_local_plan 0 2026-03-19 05:50:21 2026-03-19 05:50:21 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 0.0 --prefer_fetch_merged_part_size_threshold 1 --vertical_merge_algorithm_min_rows_to_activate 403770 --vertical_merge_algorithm_min_columns_to_activate 1 --allow_vertical_merges_from_compact_to_wide_parts 1 --min_merge_bytes_to_use_direct_io 8322071448 --index_granularity_bytes 1065442 --merge_max_block_size 11244 --index_granularity 44436 --min_bytes_for_wide_part 1073741824 --marks_compress_block_size 17243 --primary_key_compress_block_size 20824 --replace_long_file_name_to_hash 1 --max_file_name_length 128 --min_bytes_for_full_part_storage 0 --compact_parts_max_bytes_to_buffer 501691863 --compact_parts_max_granules_to_buffer 210 --compact_parts_merge_max_bytes_to_prefetch_part 20569253 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 0 --old_parts_lifetime 480 2026-03-19 05:50:21 2026-03-19 05:50:21 Database: test_zgbj67ze 2026-03-19 05:50:21 03313_case_insensitive_json_type_declaration: [ OK ] 0.22 sec. 2026-03-19 05:50:21 01615_two_args_function_index_fix: [ OK ] 0.42 sec. 2026-03-19 05:50:21 00908_bloom_filter_index: [ OK ] 15.16 sec. 2026-03-19 05:50:22 01532_clickhouse_local_tmp_folder: [ OK ] 0.67 sec. 2026-03-19 05:50:22 01213_alter_table_rename_nested: [ OK ] 0.37 sec. 2026-03-19 05:50:22 03199_join_with_materialized_column: [ OK ] 0.32 sec. 2026-03-19 05:50:22 02831_trash: [ OK ] 0.27 sec. 2026-03-19 05:50:22 01020_function_array_compact: [ OK ] 0.32 sec. 2026-03-19 05:50:22 03208_inconsistent_formatting_of_not_subquery: [ OK ] 0.62 sec. 2026-03-19 05:50:23 02907_read_buffer_content_is_cached_multiple_blobs: [ OK ] 0.57 sec. 2026-03-19 05:50:23 02126_fix_filelog: [ OK ] 2.17 sec. 2026-03-19 05:50:23 01474_custom_null_tsv: [ OK ] 1.82 sec. 2026-03-19 05:50:23 02999_variant_suspicious_types: [ OK ] 0.37 sec. 2026-03-19 05:50:24 02989_replicated_merge_tree_invalid_metadata_version: [ OK ] 0.57 sec. 2026-03-19 05:50:24 00580_consistent_hashing_functions: [ OK ] 0.32 sec. 2026-03-19 05:50:24 02973_block_number_sparse_serialization_and_mutation: [ OK ] 0.57 sec. 2026-03-19 05:50:24 01042_check_query_and_last_granule_size: [ OK ] 0.52 sec. 2026-03-19 05:50:24 01603_read_with_backoff_bug: [ OK ] 5.83 sec. 2026-03-19 05:50:24 00688_low_cardinality_alter_add_column: [ OK ] 0.38 sec. 2026-03-19 05:50:25 01825_type_json_ghdata: [ OK ] 5.48 sec. 2026-03-19 05:50:25 00678_shard_funnel_window: [ OK ] 0.42 sec. 2026-03-19 05:50:25 01201_drop_column_compact_part_replicated_zookeeper_long: [ OK ] 0.82 sec. 2026-03-19 05:50:25 02473_multistep_split_prewhere: [ OK ] 12.26 sec. 2026-03-19 05:50:25 02436_system_zookeeper_context: [ OK ] 0.37 sec. 2026-03-19 05:50:25 01276_alter_rename_column_materialized_expr: [ OK ] 0.47 sec. 2026-03-19 05:50:25 02553_type_object_analyzer: [ OK ] 0.27 sec. 2026-03-19 05:50:25 03171_direct_dict_short_circuit_bug: [ OK ] 0.32 sec. 2026-03-19 05:50:25 02161_addressToLineWithInlines: [ SKIPPED ] 0.00 sec. 2026-03-19 05:50:25 Reason: not running for current build 2026-03-19 05:50:25 02863_ignore_foreign_keys_in_tables_definition: [ OK ] 0.37 sec. 2026-03-19 05:50:26 03037_union_view: [ OK ] 0.32 sec. 2026-03-19 05:50:26 00387_use_client_time_zone: [ OK ] 0.97 sec. 2026-03-19 05:50:26 01302_polygons_distance: [ OK ] 0.42 sec. 2026-03-19 05:50:26 00404_null_literal: [ OK ] 0.32 sec. 2026-03-19 05:50:26 02233_HTTP_ranged: [ OK ] 1.27 sec. 2026-03-19 05:50:26 00180_attach_materialized_view: [ OK ] 0.32 sec. 2026-03-19 05:50:26 02246_is_secure_query_log: [ OK ] 4.04 sec. 2026-03-19 05:50:27 02560_quantile_min_max: [ OK ] 0.32 sec. 2026-03-19 05:50:27 01660_second_extremes_bug: [ OK ] 0.32 sec. 2026-03-19 05:50:27 02806_cte_block_cannot_be_empty: [ OK ] 0.27 sec. 2026-03-19 05:50:27 01600_remerge_sort_lowered_memory_bytes_ratio: [ OK ] 1.22 sec. 2026-03-19 05:50:27 02206_format_override: [ OK ] 1.37 sec. 2026-03-19 05:50:28 01017_uniqCombined_memory_usage: [ OK ] 0.82 sec. 2026-03-19 05:50:28 00811_garbage: [ OK ] 0.37 sec. 2026-03-19 05:50:28 01710_query_log_with_projection_info: [ OK ] 0.72 sec. 2026-03-19 05:50:28 02237_lzma_bug: [ OK ] 3.28 sec. 2026-03-19 05:50:28 01104_fixed_string_like: [ OK ] 0.57 sec. 2026-03-19 05:50:28 02882_primary_key_index_in_function_different_types: [ OK ] 0.37 sec. 2026-03-19 05:50:28 02911_arrow_large_list: [ OK ] 0.72 sec. 2026-03-19 05:50:28 02785_global_join_too_many_columns: [ OK ] 0.37 sec. 2026-03-19 05:50:29 02567_native_type_conversions: [ OK ] 1.37 sec. 2026-03-19 05:50:29 02477_analyzer_array_join_with_join: [ OK ] 0.62 sec. 2026-03-19 05:50:29 00072_in_types: [ OK ] 0.27 sec. 2026-03-19 05:50:29 01455_nullable_type_with_if_agg_combinator: [ OK ] 0.52 sec. 2026-03-19 05:50:29 02474_timeDiff_UTCTimestamp: [ OK ] 0.32 sec. 2026-03-19 05:50:29 03008_index_small: [ OK ] 0.37 sec. 2026-03-19 05:50:30 01746_forbid_drop_column_referenced_by_mv: [ OK ] 0.62 sec. 2026-03-19 05:50:30 01866_datetime64_cmp_with_constant: [ OK ] 0.47 sec. 2026-03-19 05:50:30 00331_final_and_prewhere: [ OK ] 0.32 sec. 2026-03-19 05:50:30 01415_sticking_mutations: [ OK ] 18.23 sec. 2026-03-19 05:50:30 01532_primary_key_without_order_by_zookeeper: [ OK ] 0.57 sec. 2026-03-19 05:50:30 00715_fetch_merged_or_mutated_part_zookeeper: [ OK ] 6.56 sec. 2026-03-19 05:50:30 01307_polygon_perimeter: [ OK ] 0.37 sec. 2026-03-19 05:50:30 02017_columns_with_dot: [ OK ] 0.37 sec. 2026-03-19 05:50:31 02680_datetime64_monotonic_check: [ OK ] 0.32 sec. 2026-03-19 05:50:31 03230_subcolumns_mv: [ OK ] 0.32 sec. 2026-03-19 05:50:31 01453_normalize_query_alias_uuid: [ OK ] 0.42 sec. 2026-03-19 05:50:31 00160_merge_and_index_in_in: [ OK ] 2.62 sec. 2026-03-19 05:50:31 01942_dateTimeToSnowflakeID: [ OK ] 0.42 sec. 2026-03-19 05:50:32 00299_stripe_log_multiple_inserts: [ OK ] 0.52 sec. 2026-03-19 05:50:32 00910_client_window_size_detection: [ OK ] 0.97 sec. 2026-03-19 05:50:32 03155_test_move_to_prewhere: [ OK ] 1.52 sec. 2026-03-19 05:50:32 01774_tuple_null_in: [ OK ] 0.32 sec. 2026-03-19 05:50:32 02185_arraySlice_negative_offset_size: [ OK ] 0.27 sec. 2026-03-19 05:50:32 01922_sum_null_for_remote: [ OK ] 0.32 sec. 2026-03-19 05:50:32 02122_parallel_formatting_RowBinaryWithNames: [ OK ] 1.68 sec. 2026-03-19 05:50:33 02047_log_family_data_file_sizes: [ OK ] 6.58 sec. 2026-03-19 05:50:33 01072_drop_temporary_table_with_same_name: [ OK ] 0.32 sec. 2026-03-19 05:50:33 00084_summing_merge_tree: [ OK ] 0.47 sec. 2026-03-19 05:50:33 02136_scalar_read_rows_json: [ OK ] 1.22 sec. 2026-03-19 05:50:33 02797_range_nullable: [ OK ] 0.37 sec. 2026-03-19 05:50:33 03095_join_filter_push_down_right_stream_filled: [ OK ] 0.32 sec. 2026-03-19 05:50:33 01032_duplicate_column_insert_query: [ OK ] 0.32 sec. 2026-03-19 05:50:33 01681_hyperscan_debug_assertion: [ SKIPPED ] 0.00 sec. 2026-03-19 05:50:33 Reason: not running for current build 2026-03-19 05:50:33 02815_range_dict_no_direct_join: [ OK ] 0.42 sec. 2026-03-19 05:50:33 01960_lambda_precedence: [ OK ] 0.32 sec. 2026-03-19 05:50:33 02517_uuid_parsing: [ OK ] 0.32 sec. 2026-03-19 05:50:34 02476_fix_cast_parser_bug: [ OK ] 0.27 sec. 2026-03-19 05:50:34 02354_parse_timedelta: [ OK ] 0.57 sec. 2026-03-19 05:50:34 02267_empty_arrays_read_reverse: [ OK ] 0.58 sec. 2026-03-19 05:50:34 01188_attach_table_from_path: [ OK ] 0.37 sec. 2026-03-19 05:50:34 02992_all_columns_should_have_comment: [ OK ] 0.67 sec. 2026-03-19 05:50:34 02243_make_date32_mysql: [ OK ] 0.47 sec. 2026-03-19 05:50:34 03215_multilinestring_geometry: [ OK ] 0.32 sec. 2026-03-19 05:50:35 00900_orc_arrays_load: [ OK ] 2.42 sec. 2026-03-19 05:50:35 01472_many_rows_in_totals: [ OK ] 0.42 sec. 2026-03-19 05:50:35 01622_defaults_for_url_engine: [ OK ] 0.87 sec. 2026-03-19 05:50:35 02266_protobuf_format_google_wrappers: [ OK ] 4.23 sec. 2026-03-19 05:50:35 03290_limit_by_segv: [ OK ] 0.27 sec. 2026-03-19 05:50:35 02906_flatten_only_true_nested: [ OK ] 0.27 sec. 2026-03-19 05:50:35 02151_hash_table_sizes_stats_distributed: [ SKIPPED ] 0.00 sec. 2026-03-19 05:50:35 Reason: not running for current build 2026-03-19 05:50:36 00981_topK_topKWeighted_long: [ OK ] 6.54 sec. 2026-03-19 05:50:36 03221_merge_profile_events: [ OK ] 0.97 sec. 2026-03-19 05:50:36 01307_orc_output_format: [ OK ] 2.32 sec. 2026-03-19 05:50:36 01268_procfs_metrics: [ OK ] 1.07 sec. 2026-03-19 05:50:36 03158_dynamic_type_from_variant: [ OK ] 0.42 sec. 2026-03-19 05:50:36 01535_decimal_round_scale_overflow_check: [ OK ] 0.32 sec. 2026-03-19 05:50:37 00909_kill_not_initialized_query: [ OK ] 8.04 sec. 2026-03-19 05:50:37 02504_disallow_arrayjoin_in_mutations: [ OK ] 0.47 sec. 2026-03-19 05:50:37 02122_parallel_formatting_JSONCompactEachRow: [ OK ] 2.07 sec. 2026-03-19 05:50:37 03034_recursive_cte_tree: [ OK ] 0.37 sec. 2026-03-19 05:50:37 01832_memory_write_suffix: [ OK ] 0.32 sec. 2026-03-19 05:50:37 03147_asof_join_ddb_missing: [ OK ] 1.57 sec. 2026-03-19 05:50:37 01451_replicated_detach_drop_and_quorum_long: [ OK ] 0.57 sec. 2026-03-19 05:50:37 00805_round_down: [ OK ] 0.57 sec. 2026-03-19 05:50:37 00910_crash_when_distributed_modify_order_by: [ OK ] 0.27 sec. 2026-03-19 05:50:37 00287_column_const_with_nan: [ OK ] 0.27 sec. 2026-03-19 05:50:38 01279_empty_external_table: [ OK ] 1.32 sec. 2026-03-19 05:50:38 01018_ambiguous_column: [ OK ] 0.37 sec. 2026-03-19 05:50:38 02763_row_policy_storage_merge_alias: [ OK ] 0.42 sec. 2026-03-19 05:50:38 02677_analyzer_compound_expressions: [ OK ] 0.47 sec. 2026-03-19 05:50:38 00033_fixed_string_to_string: [ OK ] 0.32 sec. 2026-03-19 05:50:39 01499_log_deadlock: [ OK ] 0.47 sec. 2026-03-19 05:50:39 02581_share_big_sets_between_mutation_tasks_with_storage_set: [ OK ] 1.82 sec. 2026-03-19 05:50:39 01025_array_compact_generic: [ OK ] 0.32 sec. 2026-03-19 05:50:39 01834_alias_columns_laziness_filimonov: [ OK ] 1.37 sec. 2026-03-19 05:50:39 00538_datediff: [ OK ] 0.52 sec. 2026-03-19 05:50:39 03002_modify_query_cte: [ OK ] 0.32 sec. 2026-03-19 05:50:40 01680_date_time_add_ubsan: [ OK ] 0.32 sec. 2026-03-19 05:50:40 02355_control_block_size_in_array_join: [ OK ] 0.32 sec. 2026-03-19 05:50:40 01083_window_view_select: [ OK ] 2.57 sec. 2026-03-19 05:50:40 00278_insert_already_sorted: [ OK ] 0.62 sec. 2026-03-19 05:50:40 02366_kql_mvexpand: [ OK ] 0.47 sec. 2026-03-19 05:50:40 00802_daylight_saving_time_shift_backwards_at_midnight: [ OK ] 0.27 sec. 2026-03-19 05:50:41 02513_broken_datetime64_init_on_mac: [ OK ] 0.27 sec. 2026-03-19 05:50:41 00098_g_union_all: [ OK ] 0.32 sec. 2026-03-19 05:50:41 00902_entropy: [ OK ] 0.32 sec. 2026-03-19 05:50:41 02041_test_fuzzy_alter: [ OK ] 0.32 sec. 2026-03-19 05:50:41 02968_analyzer_join_column_not_found: [ OK ] 0.27 sec. 2026-03-19 05:50:41 02294_floating_point_second_in_settings: [ OK ] 4.43 sec. 2026-03-19 05:50:42 00688_aggregation_retention: [ OK ] 0.52 sec. 2026-03-19 05:50:42 02861_filter_pushdown_const_bug: [ OK ] 0.47 sec. 2026-03-19 05:50:42 01917_prewhere_column_type: [ OK ] 0.37 sec. 2026-03-19 05:50:42 01710_force_use_projection: [ OK ] 0.32 sec. 2026-03-19 05:50:42 02746_index_analysis_binary_operator_with_null: [ OK ] 0.27 sec. 2026-03-19 05:50:42 02177_merge_optimize_aggregation_in_order: [ OK ] 0.32 sec. 2026-03-19 05:50:42 02684_bson: [ OK ] 0.27 sec. 2026-03-19 05:50:42 01802_toDateTime64_large_values: [ OK ] 0.32 sec. 2026-03-19 05:50:42 01889_check_row_policy_defined_using_user_function: [ OK ] 4.43 sec. 2026-03-19 05:50:42 01926_union_all_schmak: [ OK ] 0.28 sec. 2026-03-19 05:50:43 01333_select_abc_asterisk: [ OK ] 0.37 sec. 2026-03-19 05:50:43 03036_test_parquet_bloom_filter_push_down: [ OK ] 6.79 sec. 2026-03-19 05:50:43 02025_subcolumns_compact_parts: [ OK ] 0.37 sec. 2026-03-19 05:50:43 02380_analyzer_join_sample: [ OK ] 0.37 sec. 2026-03-19 05:50:43 02868_operator_is_not_distinct_from_priority: [ OK ] 0.27 sec. 2026-03-19 05:50:43 02981_variant_type_function: [ OK ] 0.32 sec. 2026-03-19 05:50:43 02465_limit_trivial_max_rows_to_read: [ OK ] 0.37 sec. 2026-03-19 05:50:43 02154_bitmap_contains: [ OK ] 0.37 sec. 2026-03-19 05:50:43 01392_column_resolve: [ OK ] 0.32 sec. 2026-03-19 05:50:44 00577_full_join_segfault: [ OK ] 0.32 sec. 2026-03-19 05:50:44 01497_mutation_support_for_storage_memory: [ OK ] 0.32 sec. 2026-03-19 05:50:44 00916_join_using_duplicate_columns: [ OK ] 0.42 sec. 2026-03-19 05:50:44 02377_analyzer_in_function_set: [ OK ] 0.32 sec. 2026-03-19 05:50:44 00823_capnproto_input: [ OK ] 1.77 sec. 2026-03-19 05:50:44 01156_pcg_deserialization: [ OK ] 9.94 sec. 2026-03-19 05:50:48 02493_inconsistent_hex_and_binary_number: [ OK ] 4.58 sec. 2026-03-19 05:50:48 03033_cte_numbers_memory: [ OK ] 3.72 sec. 2026-03-19 05:50:48 02875_final_invalid_read_ranges_bug: [ OK ] 0.67 sec. 2026-03-19 05:50:49 00913_many_threads: [ OK ] 4.68 sec. 2026-03-19 05:50:49 01072_json_each_row_data_in_square_brackets: [ OK ] 0.52 sec. 2026-03-19 05:50:49 02366_kql_summarize: [ OK ] 0.62 sec. 2026-03-19 05:50:50 02993_lazy_index_loading: [ OK ] 1.94 sec. 2026-03-19 05:50:50 00386_long_in_pk: [ OK ] 10.19 sec. 2026-03-19 05:50:50 01322_cast_keep_nullable: [ OK ] 0.37 sec. 2026-03-19 05:50:51 03157_dynamic_type_json: [ OK ] 0.32 sec. 2026-03-19 05:50:51 02481_i43247_ubsan_in_minmaxany: [ OK ] 1.87 sec. 2026-03-19 05:50:51 01034_JSONCompactEachRow: [ OK ] 0.77 sec. 2026-03-19 05:50:52 02990_format_select_from_explain: [ OK ] 0.62 sec. 2026-03-19 05:50:52 01950_kill_large_group_by_query: [ OK ] 1.77 sec. 2026-03-19 05:50:52 00800_low_cardinality_distributed_insert: [ OK ] 0.42 sec. 2026-03-19 05:50:52 02006_client_test_hint_error_name: [ OK ] 0.32 sec. 2026-03-19 05:50:52 01388_clear_all_columns: [ OK ] 0.42 sec. 2026-03-19 05:50:52 01533_distinct_depends_on_max_threads: [ OK ] 0.62 sec. 2026-03-19 05:50:52 00437_nulls_first_last: [ OK ] 0.52 sec. 2026-03-19 05:50:53 02999_analyzer_preimage_null: [ OK ] 0.27 sec. 2026-03-19 05:50:53 02421_new_type_json_async_insert: [ OK ] 9.59 sec. 2026-03-19 05:50:53 00846_join_using_tuple_crash: [ OK ] 0.27 sec. 2026-03-19 05:50:53 01605_skip_idx_compact_parts: [ OK ] 0.32 sec. 2026-03-19 05:50:53 01186_conversion_to_nullable: [ OK ] 0.37 sec. 2026-03-19 05:50:53 03003_analyzer_setting: [ OK ] 0.27 sec. 2026-03-19 05:50:54 01144_multiword_data_types: [ OK ] 0.27 sec. 2026-03-19 05:50:54 00037_totals_limit: [ OK ] 0.27 sec. 2026-03-19 05:50:54 03274_format_inference_create_query_file: [ OK ] 1.72 sec. 2026-03-19 05:50:54 02113_untuple_func_alias: [ OK ] 0.27 sec. 2026-03-19 05:50:55 00800_function_java_hash: [ OK ] 0.47 sec. 2026-03-19 05:50:55 00668_compare_arrays_silviucpp: [ OK ] 0.42 sec. 2026-03-19 05:50:55 02129_skip_quoted_fields: [ OK ] 10.75 sec. 2026-03-19 05:50:55 01825_type_json_4: [ OK ] 2.63 sec. 2026-03-19 05:50:55 02870_per_column_settings: [ OK ] 0.52 sec. 2026-03-19 05:50:56 01062_pm_all_join_with_block_continuation: [ OK ] 11.39 sec. 2026-03-19 05:50:56 02132_client_history_navigation: [ OK ] 0.77 sec. 2026-03-19 05:50:56 00714_alter_uuid: [ OK ] 0.32 sec. 2026-03-19 05:50:56 02860_distributed_flush_on_detach: [ OK ] 0.37 sec. 2026-03-19 05:50:56 02496_row_binary_large_string_size: [ OK ] 0.87 sec. 2026-03-19 05:50:56 00854_multiple_join_asterisks: [ OK ] 0.37 sec. 2026-03-19 05:50:57 02456_bloom_filter_assert: [ OK ] 0.52 sec. 2026-03-19 05:50:57 02021_map_bloom_filter_index: [ OK ] 0.52 sec. 2026-03-19 05:50:57 03013_forbid_attach_table_if_active_replica_already_exists: [ OK ] 2.02 sec. 2026-03-19 05:50:57 03215_view_with_recursive: [ OK ] 0.52 sec. 2026-03-19 05:50:57 00880_decimal_in_key: [ OK ] 1.42 sec. 2026-03-19 05:50:57 03038_move_partition_to_oneself_deadlock: [ OK ] 0.32 sec. 2026-03-19 05:50:57 02424_pod_array_overflow: [ OK ] 0.27 sec. 2026-03-19 05:50:58 01230_join_get_truncate: [ OK ] 0.37 sec. 2026-03-19 05:50:58 02359_send_logs_source_regexp: [ OK ] 0.82 sec. 2026-03-19 05:50:58 02007_ipv4_and_ipv6_to_and_from_string: [ OK ] 0.47 sec. 2026-03-19 05:50:58 01774_case_sensitive_connection_id: [ OK ] 0.27 sec. 2026-03-19 05:50:58 00734_timeslot: [ OK ] 0.37 sec. 2026-03-19 05:50:58 00191_aggregating_merge_tree_and_final: [ OK ] 0.37 sec. 2026-03-19 05:50:58 03071_analyzer_array_join_forbid_non_existing_columns: [ OK ] 0.27 sec. 2026-03-19 05:50:59 02884_duplicate_index_name: [ OK ] 0.37 sec. 2026-03-19 05:50:59 03039_dynamic_collapsing_merge_tree: [ OK ] 9.79 sec. 2026-03-19 05:50:59 02771_tsv_csv_custom_skip_trailing_empty_lines: [ OK ] 0.37 sec. 2026-03-19 05:50:59 02344_describe_cache: [ OK ] 1.32 sec. 2026-03-19 05:50:59 02457_csv_parse_date_out_of_range: [ OK ] 1.87 sec. 2026-03-19 05:50:59 01753_optimize_aggregation_in_order: [ OK ] 0.97 sec. 2026-03-19 05:51:00 01702_rewrite_avg_for_algebraic_optimization: [ OK ] 0.37 sec. 2026-03-19 05:51:00 02842_vertical_merge_after_add_drop_column: [ OK ] 0.42 sec. 2026-03-19 05:51:00 02374_combine_multi_if_and_count_if_opt: [ OK ] 0.32 sec. 2026-03-19 05:51:00 02326_numbers_from_json_strings_schema_inference: [ OK ] 0.32 sec. 2026-03-19 05:51:00 03305_fix_kafka_table_with_kw_arguments: [ OK ] 0.27 sec. 2026-03-19 05:51:00 00688_low_cardinality_defaults: [ OK ] 0.27 sec. 2026-03-19 05:51:00 03148_asof_join_ddb_subquery: [ OK ] 0.37 sec. 2026-03-19 05:51:00 03149_variant_pop_back_typo: [ OK ] 0.27 sec. 2026-03-19 05:51:00 03145_asof_join_ddb_inequalities: [ OK ] 0.47 sec. 2026-03-19 05:51:00 03142_untuple_crash: [ OK ] 0.37 sec. 2026-03-19 05:51:00 03151_external_cross_join: [ OK ] 1.02 sec. 2026-03-19 05:51:00 03243_create_or_replace_view_dependency_check: [ OK ] 0.32 sec. 2026-03-19 05:51:01 01119_optimize_trivial_insert_select: [ OK ] 0.57 sec. 2026-03-19 05:51:01 02240_asof_join_biginteger: [ OK ] 0.37 sec. 2026-03-19 05:51:02 02952_clickhouse_local_query_parameters_cli: [ OK ] 0.73 sec. 2026-03-19 05:51:02 00432_aggregate_function_scalars_and_constants: [ OK ] 0.47 sec. 2026-03-19 05:51:02 00341_squashing_insert_select2: [ OK ] 0.42 sec. 2026-03-19 05:51:04 01583_parallel_parsing_exception_with_offset: [ OK ] 3.33 sec. 2026-03-19 05:51:04 00395_nullable: [ OK ] 3.43 sec. 2026-03-19 05:51:04 03205_json_cast_from_string: [ OK ] 0.47 sec. 2026-03-19 05:51:05 02250_ON_CLUSTER_grant: [ OK ] 2.08 sec. 2026-03-19 05:51:05 03003_enum_and_string_compatible: [ OK ] 0.37 sec. 2026-03-19 05:51:05 03211_nested_json_merges: [ OK ] 25.83 sec. 2026-03-19 05:51:05 01281_parseDateTime64BestEffort: [ OK ] 0.58 sec. 2026-03-19 05:51:05 01425_decimal_parse_big_negative_exponent: [ OK ] 0.47 sec. 2026-03-19 05:51:05 02563_progress_when_no_rows_from_prewhere: [ SKIPPED ] 0.00 sec. 2026-03-19 05:51:05 Reason: not running for current build 2026-03-19 05:51:06 02476_query_parameters_without_serialisation: [ OK ] 0.32 sec. 2026-03-19 05:51:06 02875_json_array_as_string: [ OK ] 0.22 sec. 2026-03-19 05:51:06 02845_domain_rfc_support_ipv6: [ OK ] 0.37 sec. 2026-03-19 05:51:06 00841_temporary_table_database: [ OK ] 0.27 sec. 2026-03-19 05:51:06 00942_dataparts_500: [ OK ] 0.57 sec. 2026-03-19 05:51:07 02325_dates_schema_inference: [ OK ] 0.47 sec. 2026-03-19 05:51:08 02941_variant_type_1: [ OK ] 14.31 sec. 2026-03-19 05:51:08 02488_zero_copy_detached_parts_drop_table: [ OK ] 4.03 sec. 2026-03-19 05:51:08 02370_lost_part_intersecting_merges: [ OK ] 13.45 sec. 2026-03-19 05:51:09 02975_intdiv_with_decimal: [ OK ] 0.57 sec. 2026-03-19 05:51:09 01610_client_spawn_editor: [ OK ] 0.17 sec. 2026-03-19 05:51:10 02002_row_level_filter_bug: [ OK ] 5.28 sec. 2026-03-19 05:51:10 02496_remove_redundant_sorting_analyzer: [ OK ] 10.24 sec. 2026-03-19 05:51:10 00340_squashing_insert_select: [ OK ] 2.17 sec. 2026-03-19 05:51:10 00552_logical_functions_uint8_as_bool: [ OK ] 0.27 sec. 2026-03-19 05:51:10 02372_analyzer_join: [ OK ] 3.83 sec. 2026-03-19 05:51:11 02874_toDaysSinceYearZero: [ OK ] 0.57 sec. 2026-03-19 05:51:11 00698_validate_array_sizes_for_nested: [ OK ] 0.37 sec. 2026-03-19 05:51:11 01651_group_uniq_array_enum: [ OK ] 0.27 sec. 2026-03-19 05:51:11 00229_prewhere_column_missing: [ OK ] 0.47 sec. 2026-03-19 05:51:11 01440_big_int_exotic_casts: [ OK ] 0.62 sec. 2026-03-19 05:51:11 03173_distinct_combinator_alignment: [ OK ] 0.32 sec. 2026-03-19 05:51:11 02269_bool_map_sync_after_error: [ OK ] 3.63 sec. 2026-03-19 05:51:11 01017_bithamming_distance: [ OK ] 0.47 sec. 2026-03-19 05:51:11 01436_storage_merge_with_join_push_down: [ OK ] 0.37 sec. 2026-03-19 05:51:11 02920_alter_column_of_projections: [ OK ] 0.47 sec. 2026-03-19 05:51:12 01120_join_constants: [ OK ] 0.27 sec. 2026-03-19 05:51:12 01300_svg: [ OK ] 0.52 sec. 2026-03-19 05:51:12 00185_array_literals: [ OK ] 0.32 sec. 2026-03-19 05:51:12 00361_shared_array_offsets_and_squash_blocks: [ OK ] 0.32 sec. 2026-03-19 05:51:12 02500_remove_redundant_distinct_analyzer: [ OK ] 10.95 sec. 2026-03-19 05:51:12 01097_cyclic_defaults: [ OK ] 0.42 sec. 2026-03-19 05:51:12 02868_select_support_from_keywords: [ OK ] 0.22 sec. 2026-03-19 05:51:12 01951_distributed_push_down_limit: [ OK ] 0.27 sec. 2026-03-19 05:51:12 02714_date_date32_in: [ OK ] 0.32 sec. 2026-03-19 05:51:12 00745_compile_scalar_subquery: [ OK ] 0.42 sec. 2026-03-19 05:51:12 02932_query_settings_max_size_drop: [ OK ] 0.39 sec. 2026-03-19 05:51:12 02707_analyzer_nested_lambdas_types: [ OK ] 0.32 sec. 2026-03-19 05:51:12 00740_database_in_nested_view: [ OK ] 0.37 sec. 2026-03-19 05:51:12 01068_parens: [ OK ] 0.27 sec. 2026-03-19 05:51:13 00823_sequence_match_dfa: [ OK ] 1.07 sec. 2026-03-19 05:51:13 02784_disable_async_with_dedup_correctly: [ OK ] 6.34 sec. 2026-03-19 05:51:13 02016_summing_mt_aggregating_column: [ OK ] 0.32 sec. 2026-03-19 05:51:13 01942_dateTimeToSnowflake: [ OK ] 0.47 sec. 2026-03-19 05:51:13 01055_prewhere_bugs: [ OK ] 0.37 sec. 2026-03-19 05:51:13 01277_fromUnixTimestamp64: [ OK ] 0.47 sec. 2026-03-19 05:51:13 01600_multiple_left_join_with_aliases: [ OK ] 0.27 sec. 2026-03-19 05:51:13 02812_subquery_operators: [ OK ] 0.32 sec. 2026-03-19 05:51:13 02784_move_all_conditions_to_prewhere_analyzer_asan: [ OK ] 0.37 sec. 2026-03-19 05:51:13 00384_column_aggregate_function_insert_from: [ OK ] 0.32 sec. 2026-03-19 05:51:13 02342_window_view_different_struct: [ OK ] 0.47 sec. 2026-03-19 05:51:13 01409_topK_merge: [ OK ] 0.37 sec. 2026-03-19 05:51:13 02864_replace_regexp_string_fallback: [ OK ] 0.37 sec. 2026-03-19 05:51:13 03276_functions_to_subcolumns_lc: [ OK ] 0.32 sec. 2026-03-19 05:51:14 00757_enum_defaults_const: [ OK ] 0.37 sec. 2026-03-19 05:51:14 00560_float_leading_plus_in_exponent: [ OK ] 0.37 sec. 2026-03-19 05:51:14 02374_analyzer_array_join: [ OK ] 0.52 sec. 2026-03-19 05:51:14 01825_type_json_ephemeral: [ OK ] 0.37 sec. 2026-03-19 05:51:14 02902_add_scalar_in_all_case: [ OK ] 0.32 sec. 2026-03-19 05:51:14 03196_max_intersections_arena_crash: [ OK ] 0.32 sec. 2026-03-19 05:51:14 01470_columns_transformers: [ OK ] 0.87 sec. 2026-03-19 05:51:14 02724_persist_interval_type: [ OK ] 0.32 sec. 2026-03-19 05:51:14 00639_startsWith: [ OK ] 0.42 sec. 2026-03-19 05:51:14 02003_compress_bz2: [ OK ] 1.17 sec. 2026-03-19 05:51:15 00752_low_cardinality_left_array_join: [ OK ] 0.32 sec. 2026-03-19 05:51:15 00612_http_max_query_size_for_distributed: [ OK ] 0.42 sec. 2026-03-19 05:51:15 03003_prql_panic: [ OK ] 1.02 sec. 2026-03-19 05:51:15 01017_tuplehamming_distance: [ OK ] 0.42 sec. 2026-03-19 05:51:15 01621_sort_after_join_pipeline_stuck: [ OK ] 0.37 sec. 2026-03-19 05:51:15 01710_projection_aggregate_functions_null_for_empty: [ OK ] 0.27 sec. 2026-03-19 05:51:15 00612_union_query_with_subquery: [ OK ] 0.32 sec. 2026-03-19 05:51:15 02560_count_digits: [ OK ] 0.37 sec. 2026-03-19 05:51:15 00696_system_columns_limit: [ OK ] 0.42 sec. 2026-03-19 05:51:15 02354_numeric_literals_with_underscores: [ OK ] 0.42 sec. 2026-03-19 05:51:15 01526_initial_query_id: [ OK ] 1.78 sec. 2026-03-19 05:51:16 01104_distributed_one_test: [ OK ] 0.47 sec. 2026-03-19 05:51:16 01096_zeros: [ OK ] 0.43 sec. 2026-03-19 05:51:16 02455_improve_feedback_when_replacing_partition_with_different_primary_key: [ OK ] 0.42 sec. 2026-03-19 05:51:16 03156_analyzer_array_join_distributed: [ OK ] 0.47 sec. 2026-03-19 05:51:16 00495_reading_const_zero_column: [ OK ] 0.32 sec. 2026-03-19 05:51:16 03129_cte_with_final: [ OK ] 0.28 sec. 2026-03-19 05:51:16 00411_long_accurate_number_comparison_int4: [ OK ] 4.39 sec. 2026-03-19 05:51:16 01783_parallel_formatting_memory: [ OK ] 0.67 sec. 2026-03-19 05:51:16 02337_check_translate_qualified_names_matcher: [ OK ] 0.32 sec. 2026-03-19 05:51:16 03159_dynamic_type_all_types: [ OK ] 0.37 sec. 2026-03-19 05:51:16 00825_http_header_query_id: [ OK ] 0.62 sec. 2026-03-19 05:51:16 02131_skip_index_not_materialized: [ OK ] 0.32 sec. 2026-03-19 05:51:17 01769_extended_range_2: [ OK ] 0.42 sec. 2026-03-19 05:51:17 00666_uniq_complex_types: [ OK ] 0.47 sec. 2026-03-19 05:51:17 00650_array_enumerate_uniq_with_tuples: [ OK ] 0.42 sec. 2026-03-19 05:51:17 03152_analyzer_columns_list: [ OK ] 0.32 sec. 2026-03-19 05:51:17 02246_clickhouse_local_drop_database: [ OK ] 1.23 sec. 2026-03-19 05:51:17 03299_deep_nested_map_creation: [ OK ] 0.32 sec. 2026-03-19 05:51:17 02921_fuzzbits_with_array_join: [ OK ] 0.27 sec. 2026-03-19 05:51:17 01659_test_base64Decode_mysql_compatibility: [ OK ] 0.32 sec. 2026-03-19 05:51:17 02504_parse_datetime_best_effort_calebeaires: [ OK ] 0.32 sec. 2026-03-19 05:51:17 00141_parse_timestamp_as_datetime: [ OK ] 0.32 sec. 2026-03-19 05:51:17 00041_aggregation_remap: [ OK ] 0.32 sec. 2026-03-19 05:51:18 00483_reading_from_array_structure: [ OK ] 0.37 sec. 2026-03-19 05:51:18 02922_respect_nulls_parser: [ OK ] 0.52 sec. 2026-03-19 05:51:18 00700_decimal_in_keys: [ OK ] 0.37 sec. 2026-03-19 05:51:18 01259_dictionary_custom_settings_ddl: [ OK ] 0.37 sec. 2026-03-19 05:51:18 01748_partition_id_pruning: [ OK ] 0.37 sec. 2026-03-19 05:51:18 01036_union_different_columns: [ OK ] 0.27 sec. 2026-03-19 05:51:18 02899_distributed_limit_by: [ OK ] 0.62 sec. 2026-03-19 05:51:18 01839_join_to_subqueries_rewriter_columns_matcher: [ OK ] 0.37 sec. 2026-03-19 05:51:19 02890_describe_table_options: [ OK ] 0.42 sec. 2026-03-19 05:51:19 02461_prewhere_row_level_policy_lightweight_delete: [ OK ] 1.02 sec. 2026-03-19 05:51:19 02354_with_statement_non_exist_column: [ OK ] 0.27 sec. 2026-03-19 05:51:19 00487_if_array_fixed_string: [ OK ] 0.27 sec. 2026-03-19 05:51:19 01691_DateTime64_clamp: [ OK ] 0.42 sec. 2026-03-19 05:51:19 01234_to_string_monotonic: [ OK ] 0.42 sec. 2026-03-19 05:51:19 00725_join_on_bug_3: [ OK ] 0.37 sec. 2026-03-19 05:51:20 01508_query_obfuscator: [ OK ] 0.72 sec. 2026-03-19 05:51:20 01444_create_table_drop_database_race: [ OK ] 10.75 sec. 2026-03-19 05:51:20 01317_no_password_in_command_line: [ OK ] 4.53 sec. 2026-03-19 05:51:20 02477_age_datetime64: [ OK ] 0.47 sec. 2026-03-19 05:51:20 02376_analyzer_in_function_subquery: [ OK ] 0.37 sec. 2026-03-19 05:51:20 02456_alter-nullable-column-bag-2: [ OK ] 0.37 sec. 2026-03-19 05:51:20 02274_full_sort_join_nodistinct: [ OK ] 3.28 sec. 2026-03-19 05:51:20 02500_analyzer_storage_view_crash_fix: [ OK ] 0.42 sec. 2026-03-19 05:51:20 00038_totals_limit: [ OK ] 0.22 sec. 2026-03-19 05:51:20 01326_hostname_alias: [ OK ] 0.27 sec. 2026-03-19 05:51:20 02815_fix_not_found_constants_col_in_block: [ OK ] 0.37 sec. 2026-03-19 05:51:20 02154_bit_slice_for_fixedstring: [ OK ] 0.92 sec. 2026-03-19 05:51:21 00535_parse_float_scientific: [ OK ] 0.32 sec. 2026-03-19 05:51:21 00637_sessions_in_http_interface_and_settings: [ OK ] 0.57 sec. 2026-03-19 05:51:21 02421_type_json_async_insert: [ OK ] 2.68 sec. 2026-03-19 05:51:21 03289_explain_syntax_statistics: [ OK ] 0.27 sec. 2026-03-19 05:51:21 01544_errorCodeToName: [ OK ] 0.32 sec. 2026-03-19 05:51:21 01657_test_toHour_mysql_compatibility: [ OK ] 0.27 sec. 2026-03-19 05:51:21 02900_matview_create_to_errors: [ OK ] 0.72 sec. 2026-03-19 05:51:21 01778_where_with_column_name: [ OK ] 0.32 sec. 2026-03-19 05:51:21 01529_union_distinct_and_setting_union_default_mode: [ OK ] 0.42 sec. 2026-03-19 05:51:21 02115_map_contains_analyzer: [ OK ] 0.27 sec. 2026-03-19 05:51:21 01039_mergetree_exec_time: [ OK ] 1.27 sec. 2026-03-19 05:51:21 02676_trailing_commas: [ OK ] 0.32 sec. 2026-03-19 05:51:21 01869_reinterpret_as_fixed_string_uuid: [ OK ] 0.27 sec. 2026-03-19 05:51:21 02918_join_pm_lc_crash: [ OK ] 0.32 sec. 2026-03-19 05:51:22 02026_arrayDifference_const: [ OK ] 0.27 sec. 2026-03-19 05:51:22 01621_summap_check_types: [ OK ] 0.32 sec. 2026-03-19 05:51:22 01937_nested_chinese: [ OK ] 0.32 sec. 2026-03-19 05:51:22 03115_alias_exists_column: [ OK ] 0.27 sec. 2026-03-19 05:51:22 03262_test_parquet_native_reader_int_logical_type: [ OK ] 1.27 sec. 2026-03-19 05:51:22 02276_full_sort_join_unsupported: [ OK ] 0.37 sec. 2026-03-19 05:51:22 03156_group_concat: [ OK ] 0.67 sec. 2026-03-19 05:51:23 01421_assert_in_in: [ OK ] 0.32 sec. 2026-03-19 05:51:23 01490_nullable_string_to_enum: [ OK ] 0.32 sec. 2026-03-19 05:51:23 01053_if_chain_check: [ OK ] 0.37 sec. 2026-03-19 05:51:23 00566_enum_min_max: [ OK ] 0.27 sec. 2026-03-19 05:51:23 02243_in_ip_address: [ OK ] 0.27 sec. 2026-03-19 05:51:23 02225_hints_for_indeices: [ OK ] 2.02 sec. 2026-03-19 05:51:24 01031_mutations_interpreter_and_context: [ OK ] 2.38 sec. 2026-03-19 05:51:24 01136_multiple_sets: [ OK ] 0.27 sec. 2026-03-19 05:51:24 01189_create_as_table_as_table_function: [ OK ] 0.27 sec. 2026-03-19 05:51:24 02702_allow_skip_errors_enum: [ OK ] 1.57 sec. 2026-03-19 05:51:24 02316_hierarchical_dictionaries_nullable_parent_key: [ OK ] 0.67 sec. 2026-03-19 05:51:24 01626_cnf_test: [ OK ] 0.32 sec. 2026-03-19 05:51:24 01470_test_insert_select_asterisk: [ OK ] 0.37 sec. 2026-03-19 05:51:24 02016_agg_empty_result_bug_28880: [ OK ] 0.27 sec. 2026-03-19 05:51:25 03039_recursive_cte_postgres_5: [ OK ] 0.37 sec. 2026-03-19 05:51:25 01513_defaults_on_defaults_no_column: [ OK ] 0.32 sec. 2026-03-19 05:51:25 01521_format_readable_time_delta2: [ OK ] 0.32 sec. 2026-03-19 05:51:25 02270_errors_in_files: [ OK ] 3.18 sec. 2026-03-19 05:51:25 02803_backup_tmp_files: [ OK ] 1.42 sec. 2026-03-19 05:51:25 01259_datetime64_ubsan: [ OK ] 0.37 sec. 2026-03-19 05:51:25 00700_decimal_empty_aggregates: [ OK ] 0.57 sec. 2026-03-19 05:51:25 00999_join_on_expression: [ OK ] 0.52 sec. 2026-03-19 05:51:25 02891_alter_update_adaptive_granularity: [ OK ] 0.27 sec. 2026-03-19 05:51:25 02985_if_over_big_int_decimal: [ OK ] 0.37 sec. 2026-03-19 05:51:26 02731_parallel_replicas_join_subquery: [ OK ] 0.83 sec. 2026-03-19 05:51:26 01043_categorical_iv: [ OK ] 0.37 sec. 2026-03-19 05:51:26 02559_add_parts: [ OK ] 0.32 sec. 2026-03-19 05:51:26 01131_max_rows_to_sort: [ OK ] 0.27 sec. 2026-03-19 05:51:26 01492_array_join_crash_13829: [ OK ] 0.27 sec. 2026-03-19 05:51:26 02366_kql_func_ip: [ OK ] 1.12 sec. 2026-03-19 05:51:26 01351_geohash_assert: [ OK ] 0.22 sec. 2026-03-19 05:51:26 00554_nested_and_table_engines: [ OK ] 0.57 sec. 2026-03-19 05:51:27 02337_join_analyze_stuck: [ OK ] 0.47 sec. 2026-03-19 05:51:27 00277_array_filter: [ OK ] 0.27 sec. 2026-03-19 05:51:27 00825_protobuf_format_splitted_nested: [ OK ] 1.87 sec. 2026-03-19 05:51:27 00951_ngram_search: [ OK ] 1.07 sec. 2026-03-19 05:51:28 02903_client_insert_in_background: [ OK ] 1.48 sec. 2026-03-19 05:51:28 01714_alter_drop_version: [ OK ] 0.32 sec. 2026-03-19 05:51:28 02311_system_zookeeper_insert: [ OK ] 0.52 sec. 2026-03-19 05:51:28 01410_nullable_key_and_index_negate_cond: [ OK ] 0.47 sec. 2026-03-19 05:51:28 00730_unicode_terminal_format: [ OK ] 0.37 sec. 2026-03-19 05:51:28 02353_partition_prune_nullable_key: [ OK ] 0.32 sec. 2026-03-19 05:51:28 02021_prewhere_column_optimization: [ OK ] 0.27 sec. 2026-03-19 05:51:28 02442_auxiliary_zookeeper_endpoint_id: [ OK ] 0.47 sec. 2026-03-19 05:51:28 00897_flatten: [ OK ] 0.37 sec. 2026-03-19 05:51:29 02789_functions_after_sorting_and_columns_with_same_names_bug: [ OK ] 0.37 sec. 2026-03-19 05:51:29 01461_query_start_time_microseconds: [ OK ] 0.62 sec. 2026-03-19 05:51:29 01011_group_uniq_array_memsan: [ OK ] 0.32 sec. 2026-03-19 05:51:29 01655_plan_optimizations: [ OK ] 12.50 sec. 2026-03-19 05:51:29 02129_add_column_add_ttl: [ OK ] 0.52 sec. 2026-03-19 05:51:29 03002_analyzer_prewhere: [ OK ] 0.32 sec. 2026-03-19 05:51:29 00839_bitmask_negative: [ OK ] 0.32 sec. 2026-03-19 05:51:29 00834_kill_mutation_replicated_zookeeper: [ SKIPPED ] 0.00 sec. 2026-03-19 05:51:29 Reason: not running for current build 2026-03-19 05:51:29 02521_incorrect_dealy_for_insert_bug_44902: [ OK ] 9.24 sec. 2026-03-19 05:51:29 00860_unknown_identifier_bug: [ OK ] 0.32 sec. 2026-03-19 05:51:29 02521_analyzer_array_join_crash: [ OK ] 0.32 sec. 2026-03-19 05:51:30 00820_multiple_joins_subquery_requires_alias: [ OK ] 0.42 sec. 2026-03-19 05:51:30 02784_schema_inference_null_as_default: [ OK ] 0.27 sec. 2026-03-19 05:51:30 02802_clickhouse_disks_s3_copy: [ OK ] 1.22 sec. 2026-03-19 05:51:30 00439_fixed_string_filter: [ OK ] 0.22 sec. 2026-03-19 05:51:30 01276_system_licenses: [ OK ] 0.32 sec. 2026-03-19 05:51:31 02464_decimal_scale_buffer_overflow: [ OK ] 0.37 sec. 2026-03-19 05:51:31 01088_benchmark_query_id: [ OK ] 1.52 sec. 2026-03-19 05:51:31 03134_positional_arguments: [ OK ] 2.07 sec. 2026-03-19 05:51:31 02982_parallel_replicas_unexpected_cluster: [ OK ] 0.32 sec. 2026-03-19 05:51:31 01305_polygons_union: [ OK ] 0.37 sec. 2026-03-19 05:51:31 00061_merge_tree_alter: [ OK ] 0.52 sec. 2026-03-19 05:51:31 02422_read_numbers_as_strings: [ OK ] 0.27 sec. 2026-03-19 05:51:32 01458_count_digits: [ OK ] 0.37 sec. 2026-03-19 05:51:32 00818_alias_bug_4110: [ OK ] 0.37 sec. 2026-03-19 05:51:32 02661_quantile_approx: [ OK ] 0.57 sec. 2026-03-19 05:51:32 03169_display_column_names_in_footer: [ OK ] 0.37 sec. 2026-03-19 05:51:33 02112_delayed_clickhouse_client_with_queries_file: [ OK ] 0.82 sec. 2026-03-19 05:51:33 01681_bloom_filter_nullable_column: [ OK ] 0.48 sec. 2026-03-19 05:51:33 02915_lazy_loading_of_base_backups: [ OK ] 3.88 sec. 2026-03-19 05:51:34 00742_require_join_strictness: [ OK ] 0.32 sec. 2026-03-19 05:51:34 01399_http_request_headers: [ OK ] 0.72 sec. 2026-03-19 05:51:34 02177_sum_if_not_found: [ OK ] 0.37 sec. 2026-03-19 05:51:34 02872_null_as_default_nested: [ OK ] 3.73 sec. 2026-03-19 05:51:34 02150_index_hypothesis_race_long: [ OK ] 5.53 sec. 2026-03-19 05:51:34 00968_roundAge: [ OK ] 0.27 sec. 2026-03-19 05:51:34 00752_low_cardinality_array_result: [ OK ] 0.27 sec. 2026-03-19 05:51:35 01813_quantileBfloat16_nans: [ OK ] 0.32 sec. 2026-03-19 05:51:35 01817_storage_buffer_parameters: [ OK ] 0.32 sec. 2026-03-19 05:51:35 00372_cors_header: [ OK ] 0.62 sec. 2026-03-19 05:51:35 02923_cte_equality_disjunction: [ OK ] 0.27 sec. 2026-03-19 05:51:35 00411_long_accurate_number_comparison_int1: [ OK ] 11.80 sec. 2026-03-19 05:51:35 03144_fuzz_quoted_type_name: [ OK ] 0.27 sec. 2026-03-19 05:51:35 00556_array_intersect: [ OK ] 0.32 sec. 2026-03-19 05:51:35 02798_explain_settings_not_applied_bug: [ OK ] 0.32 sec. 2026-03-19 05:51:35 01881_create_as_tuple: [ OK ] 0.37 sec. 2026-03-19 05:51:36 01710_projection_optimize_materialize: [ OK ] 0.63 sec. 2026-03-19 05:51:36 02962_indexHint_rpn_construction: [ OK ] 0.27 sec. 2026-03-19 05:51:36 02674_trivial_count_analyzer: [ OK ] 0.52 sec. 2026-03-19 05:51:36 01091_insert_with_default_json: [ OK ] 0.32 sec. 2026-03-19 05:51:36 01010_pmj_skip_blocks: [ OK ] 0.87 sec. 2026-03-19 05:51:37 01558_transform_null_in: [ OK ] 0.37 sec. 2026-03-19 05:51:37 02455_default_union_except_intersect: [ OK ] 0.62 sec. 2026-03-19 05:51:37 02286_tuple_numeric_identifier: [ OK ] 0.37 sec. 2026-03-19 05:51:37 02254_projection_broken_part: [ OK ] 4.34 sec. 2026-03-19 05:51:37 00440_nulls_merge_tree: [ OK ] 0.37 sec. 2026-03-19 05:51:38 00944_ml_test: [ OK ] 0.43 sec. 2026-03-19 05:51:38 01930_optimize_skip_unused_shards_rewrite_in: [ OK ] 0.92 sec. 2026-03-19 05:51:38 00052_all_left_join: [ OK ] 0.27 sec. 2026-03-19 05:51:38 02325_compatibility_setting_2: [ OK ] 0.38 sec. 2026-03-19 05:51:39 01731_async_task_queue_wait: [ OK ] 2.98 sec. 2026-03-19 05:51:39 00098_7_union_all: [ OK ] 0.27 sec. 2026-03-19 05:51:39 00188_constants_as_arguments_of_aggregate_functions: [ OK ] 0.32 sec. 2026-03-19 05:51:39 02907_clickhouse_dictionary_bug: [ OK ] 0.82 sec. 2026-03-19 05:51:39 01362_year_of_ISO8601_week_modificators_for_formatDateTime: [ OK ] 0.32 sec. 2026-03-19 05:51:39 03214_backup_and_clear_old_temporary_directories: [ OK ] 3.73 sec. 2026-03-19 05:51:40 02366_asof_optimize_predicate_bug_37813: [ OK ] 0.32 sec. 2026-03-19 05:51:40 01567_system_processes_current_database: [ OK ] 0.27 sec. 2026-03-19 05:51:40 02894_ast_depth_check: [ OK ] 0.77 sec. 2026-03-19 05:51:40 01560_DateTime_and_DateTime64_comparision: [ OK ] 0.37 sec. 2026-03-19 05:51:40 01406_carriage_return_in_tsv_csv: [ OK ] 1.37 sec. 2026-03-19 05:51:40 02721_url_cluster: [ OK ] 0.57 sec. 2026-03-19 05:51:40 02383_join_and_filtering_set: [ OK ] 3.53 sec. 2026-03-19 05:51:40 02954_analyzer_fuzz_i57086: [ OK ] 0.27 sec. 2026-03-19 05:51:40 00209_insert_select_extremes: [ OK ] 0.37 sec. 2026-03-19 05:51:40 01520_client_print_query_id: [ OK ] 0.77 sec. 2026-03-19 05:51:41 02552_analyzer_optimize_group_by_function_keys_crash: [ OK ] 0.27 sec. 2026-03-19 05:51:41 00999_join_not_nullable_types: [ OK ] 0.32 sec. 2026-03-19 05:51:41 00916_add_materialized_column_after: [ OK ] 0.32 sec. 2026-03-19 05:51:41 00002_system_numbers: [ OK ] 0.37 sec. 2026-03-19 05:51:41 01125_generate_random_qoega: [ OK ] 0.57 sec. 2026-03-19 05:51:41 00307_format_xml: [ OK ] 0.32 sec. 2026-03-19 05:51:42 02428_index_analysis_with_null_literal: [ OK ] 0.72 sec. 2026-03-19 05:51:42 02457_tuple_of_intervals: [ OK ] 0.57 sec. 2026-03-19 05:51:42 00515_shard_desc_table_functions_and_subqueries: [ OK ] 0.32 sec. 2026-03-19 05:51:42 01273_arrow_decimal: [ OK ] 2.07 sec. 2026-03-19 05:51:43 02915_fpc_overflow: [ OK ] 0.97 sec. 2026-03-19 05:51:43 00953_indices_alter_exceptions: [ OK ] 1.77 sec. 2026-03-19 05:51:43 00956_http_prepared_statements: [ OK ] 0.67 sec. 2026-03-19 05:51:43 00265_http_content_type_format_timezone: [ OK ] 1.07 sec. 2026-03-19 05:51:43 03065_analyzer_cross_join_and_array_join: [ OK ] 0.27 sec. 2026-03-19 05:51:44 03111_inner_join_group_by: [ OK ] 0.27 sec. 2026-03-19 05:51:44 00955_complex_prepared_statements: [ OK ] 3.28 sec. 2026-03-19 05:51:44 03143_join_filter_push_down_filled_join_fix: [ OK ] 0.32 sec. 2026-03-19 05:51:44 02207_s3_content_type: [ OK ] 1.22 sec. 2026-03-19 05:51:44 02961_analyzer_low_cardinality_fuzzer: [ OK ] 0.27 sec. 2026-03-19 05:51:45 01289_min_execution_speed_not_too_early: [ OK ] 0.82 sec. 2026-03-19 05:51:45 01118_is_constant: [ OK ] 0.37 sec. 2026-03-19 05:51:46 01176_mysql_client_interactive: [ OK ] 1.12 sec. 2026-03-19 05:51:46 00574_empty_strings_deserialization: [ OK ] 2.07 sec. 2026-03-19 05:51:47 03010_view_prewhere_in: [ OK ] 0.32 sec. 2026-03-19 05:51:47 00712_prewhere_with_alias_bug: [ OK ] 0.27 sec. 2026-03-19 05:51:47 00098_j_union_all: [ OK ] 0.27 sec. 2026-03-19 05:51:47 03037_dynamic_merges_1_horizontal_compact_wide_tree: [ OK ] 2.98 sec. 2026-03-19 05:51:47 01655_agg_if_nullable: [ OK ] 0.32 sec. 2026-03-19 05:51:47 02578_ipv4_codec_t64: [ OK ] 0.22 sec. 2026-03-19 05:51:48 01245_limit_infinite_sources: [ OK ] 0.82 sec. 2026-03-19 05:51:48 00836_indices_alter_replicated_zookeeper_long: [ OK ] 0.77 sec. 2026-03-19 05:51:48 00697_in_subquery_shard: [ OK ] 0.47 sec. 2026-03-19 05:51:48 01825_type_json_nbagames: [ OK ] 5.38 sec. 2026-03-19 05:51:49 00900_null_array_orc_load: [ OK ] 1.52 sec. 2026-03-19 05:51:49 01413_if_array_uuid: [ OK ] 0.27 sec. 2026-03-19 05:51:49 02313_cross_join_dup_col_names: [ OK ] 0.27 sec. 2026-03-19 05:51:49 01562_agg_null_for_empty_ahead: [ OK ] 0.37 sec. 2026-03-19 05:51:49 01137_sample_final: [ OK ] 0.42 sec. 2026-03-19 05:51:49 02306_window_move_row_number_fix: [ OK ] 0.27 sec. 2026-03-19 05:51:50 00929_multi_match_edit_distance: [ OK ] 1.22 sec. 2026-03-19 05:51:50 00751_low_cardinality_nullable_group_by: [ OK ] 0.87 sec. 2026-03-19 05:51:50 02507_to_unix_timestamp_overflow: [ OK ] 0.32 sec. 2026-03-19 05:51:50 01416_join_totals_header_bug: [ OK ] 0.32 sec. 2026-03-19 05:51:51 01030_limit_by_with_ties_error: [ OK ] 1.42 sec. 2026-03-19 05:51:51 02455_extract_fixed_string_from_nested_json: [ OK ] 0.27 sec. 2026-03-19 05:51:51 02941_variant_type_4: [ OK ] 19.62 sec. 2026-03-19 05:51:51 01099_operators_date_and_timestamp: [ OK ] 0.67 sec. 2026-03-19 05:51:52 01554_row_number_after_cannot_read_all_data: [ OK ] 0.87 sec. 2026-03-19 05:51:52 01034_with_fill_and_push_down_predicate: [ OK ] 0.37 sec. 2026-03-19 05:51:52 02935_format_with_arbitrary_types: [ OK ] 0.57 sec. 2026-03-19 05:51:52 01787_arena_assert_column_nothing: [ OK ] 0.27 sec. 2026-03-19 05:51:52 02009_array_join_partition: [ OK ] 0.42 sec. 2026-03-19 05:51:52 02737_arrayJaccardIndex: [ OK ] 0.42 sec. 2026-03-19 05:51:52 02324_compatibility_setting: [ OK ] 2.57 sec. 2026-03-19 05:51:53 01267_alter_default_key_columns_zookeeper_long: [ OK ] 0.57 sec. 2026-03-19 05:51:53 01831_max_streams: [ OK ] 0.32 sec. 2026-03-19 05:51:53 03034_ddls_and_merges_with_unusual_maps: [ OK ] 0.37 sec. 2026-03-19 05:51:55 02539_settings_alias: [ OK ] 2.68 sec. 2026-03-19 05:51:56 01581_deduplicate_by_columns_replicated_long: [ OK ] 0.67 sec. 2026-03-19 05:51:56 01492_format_readable_quantity: [ OK ] 0.22 sec. 2026-03-19 05:51:56 02010_array_index_bad_cast: [ OK ] 0.27 sec. 2026-03-19 05:51:57 02896_cyclic_aliases_crash: [ OK ] 0.37 sec. 2026-03-19 05:51:57 02843_backup_use_same_password_for_base_backup: [ OK ] 3.93 sec. 2026-03-19 05:51:57 03042_not_found_column_c1: [ OK ] 0.32 sec. 2026-03-19 05:51:58 00183_skip_unavailable_shards: [ OK ] 24.28 sec. 2026-03-19 05:51:59 02718_cli_dashed_options_parsing: [ OK ] 2.23 sec. 2026-03-19 05:51:59 02015_async_inserts_1: [ OK ] 6.53 sec. 2026-03-19 05:51:59 01312_case_insensitive_regexp: [ OK ] 0.32 sec. 2026-03-19 05:51:59 03273_dictionary_rbac: [ OK ] 2.18 sec. 2026-03-19 05:52:00 02366_explain_query_tree: [ OK ] 0.37 sec. 2026-03-19 05:52:00 01013_totals_without_aggregation: [ OK ] 0.32 sec. 2026-03-19 05:52:00 02228_merge_tree_insert_memory_usage: [ OK ] 1.07 sec. 2026-03-19 05:52:00 02345_create_table_allow_trailing_comma: [ OK ] 0.32 sec. 2026-03-19 05:52:01 01032_cityHash64_for_decimal: [ OK ] 0.27 sec. 2026-03-19 05:52:01 03160_dynamic_type_agg: [ OK ] 0.37 sec. 2026-03-19 05:52:01 01403_datetime64_constant_arg: [ OK ] 0.27 sec. 2026-03-19 05:52:01 03161_cnf_reduction: [ OK ] 0.42 sec. 2026-03-19 05:52:02 03261_sort_cursor_crash: [ OK ] 0.37 sec. 2026-03-19 05:52:02 02122_parallel_formatting_JSONCompactEachRowWithNames: [ OK ] 2.12 sec. 2026-03-19 05:52:02 02294_system_certificates: [ OK ] 0.32 sec. 2026-03-19 05:52:02 03164_analyzer_validate_tree_size: [ OK ] 0.42 sec. 2026-03-19 05:52:02 02097_remove_sample_by: [ OK ] 0.37 sec. 2026-03-19 05:52:03 01753_mutate_table_predicated_with_table: [ OK ] 0.42 sec. 2026-03-19 05:52:03 01249_flush_interactive: [ OK ] 10.60 sec. 2026-03-19 05:52:03 00400_client_external_options: [ OK ] 2.02 sec. 2026-03-19 05:52:03 02012_changed_enum_type_non_replicated: [ OK ] 0.42 sec. 2026-03-19 05:52:03 00732_quorum_insert_simple_test_1_parts_zookeeper_long: [ OK ] 0.62 sec. 2026-03-19 05:52:04 01475_read_subcolumns_3: [ OK ] 0.47 sec. 2026-03-19 05:52:04 01273_arrow_stream: [ OK ] 15.91 sec. 2026-03-19 05:52:04 02481_low_cardinality_with_short_circuit_functins: [ OK ] 0.37 sec. 2026-03-19 05:52:04 02531_ipv4_arithmetic: [ OK ] 0.32 sec. 2026-03-19 05:52:04 02242_throw_if_constant_argument: [ OK ] 0.27 sec. 2026-03-19 05:52:04 02932_idna: [ OK ] 0.82 sec. 2026-03-19 05:52:04 03152_join_filter_push_down_equivalent_columns: [ OK ] 0.37 sec. 2026-03-19 05:52:05 02114_bool_type: [ OK ] 0.37 sec. 2026-03-19 05:52:05 01917_system_data_skipping_indices: [ OK ] 0.37 sec. 2026-03-19 05:52:06 02456_alter-nullable-column-bag: [ OK ] 0.37 sec. 2026-03-19 05:52:06 02864_filtered_url_with_globs: [ OK ] 1.92 sec. 2026-03-19 05:52:06 02873_s3_presigned_url_and_url_with_special_characters: [ OK ] 8.49 sec. 2026-03-19 05:52:06 02722_matcher_join_use_nulls: [ OK ] 0.72 sec. 2026-03-19 05:52:07 02394_every_profile_event_must_have_documentation: [ OK ] 0.27 sec. 2026-03-19 05:52:07 02692_multiple_joins_unicode: [ OK ] 0.37 sec. 2026-03-19 05:52:07 02783_parallel_replicas_trivial_count_optimization: [ OK ] 3.48 sec. 2026-03-19 05:52:07 02918_template_format_deadlock: [ OK ] 0.72 sec. 2026-03-19 05:52:07 00700_decimal_casts: [ OK ] 1.32 sec. 2026-03-19 05:52:08 00963_startsWith_force_primary_key: [ OK ] 0.32 sec. 2026-03-19 05:52:08 00676_group_by_in: [ OK ] 0.37 sec. 2026-03-19 05:52:08 01282_system_parts_ttl_info: [ OK ] 0.37 sec. 2026-03-19 05:52:08 03258_old_analyzer_const_expr_bug: [ OK ] 0.32 sec. 2026-03-19 05:52:08 00564_initial_column_values_with_default_expression: [ OK ] 0.32 sec. 2026-03-19 05:52:08 02235_check_table_sparse_serialization: [ OK ] 0.32 sec. 2026-03-19 05:52:09 03156_nullable_number_tips: [ OK ] 0.37 sec. 2026-03-19 05:52:09 02029_test_implemented_methods: [ OK ] 0.57 sec. 2026-03-19 05:52:09 00608_uniq_array: [ OK ] 0.27 sec. 2026-03-19 05:52:09 00217_shard_global_subquery_columns_with_same_name: [ OK ] 0.32 sec. 2026-03-19 05:52:09 02953_slow_create_view: [ OK ] 0.37 sec. 2026-03-19 05:52:09 02354_vector_search_default_granularity: [ OK ] 0.37 sec. 2026-03-19 05:52:10 02693_multiple_joins_in: [ OK ] 0.27 sec. 2026-03-19 05:52:10 02016_bit_shift_right_for_string_integer: [ OK ] 0.72 sec. 2026-03-19 05:52:10 01232_untuple: [ OK ] 0.47 sec. 2026-03-19 05:52:11 00647_multiply_aggregation_state: [ OK ] 0.42 sec. 2026-03-19 05:52:12 02125_lz4_compression_bug_Values: [ OK ] 4.88 sec. 2026-03-19 05:52:12 03167_base64_url_functions_sh: [ OK ] 46.10 sec. 2026-03-19 05:52:12 02493_do_not_assume_that_the_original_query_was_valid_when_transforming_joins: [ OK ] 0.32 sec. 2026-03-19 05:52:12 00740_optimize_predicate_expression: [ OK ] 0.32 sec. 2026-03-19 05:52:12 00581_limit_on_result_and_subquery_and_insert: [ OK ] 0.37 sec. 2026-03-19 05:52:12 00626_replace_partition_from_table_zookeeper: [ OK ] 29.69 sec. 2026-03-19 05:52:13 01702_toDateTime_from_string_clamping: [ OK ] 0.37 sec. 2026-03-19 05:52:13 02840_grace_hash_join_structure_mismatch: [ OK ] 0.47 sec. 2026-03-19 05:52:13 00628_in_lambda_on_merge_table_bug: [ OK ] 0.37 sec. 2026-03-19 05:52:13 02426_orc_bug: [ OK ] 0.87 sec. 2026-03-19 05:52:13 01914_ubsan_quantile_timing: [ OK ] 0.27 sec. 2026-03-19 05:52:14 00986_materialized_view_stack_overflow: [ OK ] 0.77 sec. 2026-03-19 05:52:14 02713_array_low_cardinality_string: [ OK ] 0.32 sec. 2026-03-19 05:52:14 01710_projections_and_duplicate_columms: [ OK ] 0.47 sec. 2026-03-19 05:52:14 00653_verification_monotonic_data_load: [ OK ] 12.35 sec. 2026-03-19 05:52:14 01795_TinyLog_rwlock_ub: [ OK ] 0.32 sec. 2026-03-19 05:52:15 01660_join_or_inner: [ OK ] 0.53 sec. 2026-03-19 05:52:15 01070_alter_with_ttl: [ OK ] 0.32 sec. 2026-03-19 05:52:15 02490_replacing_merge_tree_is_deleted_column: [ OK ] 1.12 sec. 2026-03-19 05:52:15 01650_expressions_merge_bug: [ OK ] 0.37 sec. 2026-03-19 05:52:16 01001_rename_merge_race_condition: [ OK ] 11.80 sec. 2026-03-19 05:52:16 02016_aggregation_spark_bar: [ OK ] 0.62 sec. 2026-03-19 05:52:16 03246_alter_update_dynamic_hung: [ OK ] 0.87 sec. 2026-03-19 05:52:16 02017_columns_with_dot_2: [ OK ] 0.32 sec. 2026-03-19 05:52:16 02789_reading_from_s3_with_connection_pool: [ OK ] 5.94 sec. 2026-03-19 05:52:16 02562_with_fill_nullable: [ OK ] 0.27 sec. 2026-03-19 05:52:16 01939_network_receive_bytes_metrics: [ OK ] 1.57 sec. 2026-03-19 05:52:16 02184_range_hashed_dictionary_outside_range_values: [ OK ] 0.42 sec. 2026-03-19 05:52:16 03013_ignore_drop_queries_probability: [ OK ] 0.42 sec. 2026-03-19 05:52:17 02521_tsv_csv_custom_header_detection: [ OK ] 8.44 sec. 2026-03-19 05:52:17 02286_convert_decimal_type: [ OK ] 0.27 sec. 2026-03-19 05:52:17 02255_broken_parts_chain_on_start: [ OK ] 6.09 sec. 2026-03-19 05:52:17 02124_encrypt_decrypt_nullable: [ OK ] 0.37 sec. 2026-03-19 05:52:17 00701_join_default_strictness: [ OK ] 0.32 sec. 2026-03-19 05:52:17 02680_default_star: [ OK ] 0.27 sec. 2026-03-19 05:52:17 01014_function_repeat_corner_cases: [ OK ] 0.32 sec. 2026-03-19 05:52:17 00196_float32_formatting: [ OK ] 0.27 sec. 2026-03-19 05:52:17 03040_dynamic_type_alters_1_memory: [ OK ] 0.57 sec. 2026-03-19 05:52:18 02515_tuple_lambda_parsing: [ OK ] 0.22 sec. 2026-03-19 05:52:18 00976_system_stop_ttl_merges: [ OK ] 1.42 sec. 2026-03-19 05:52:18 02457_filesystem_function: [ OK ] 0.27 sec. 2026-03-19 05:52:19 01273_arrow_nullable_arrays_load: [ OK ] 2.13 sec. 2026-03-19 05:52:19 01720_join_implicit_cast: [ OK ] 1.22 sec. 2026-03-19 05:52:19 01825_new_type_json_12: [ OK ] 3.13 sec. 2026-03-19 05:52:19 01940_totimezone_operator_monotonicity: [ OK ] 0.37 sec. 2026-03-19 05:52:20 02357_query_cancellation_race: [ OK ] 6.54 sec. 2026-03-19 05:52:20 02896_optimize_array_exists_to_has_with_date: [ OK ] 0.27 sec. 2026-03-19 05:52:20 01710_projections_order_by_complete: [ OK ] 0.32 sec. 2026-03-19 05:52:20 01710_projection_array_join: [ OK ] 0.42 sec. 2026-03-19 05:52:20 02354_vector_search_detach_attach: [ OK ] 0.27 sec. 2026-03-19 05:52:21 01891_partition_hash_no_long_int: [ OK ] 0.32 sec. 2026-03-19 05:52:21 01576_alias_column_rewrite: [ OK ] 0.72 sec. 2026-03-19 05:52:21 02136_kill_scalar_queries: [ OK ] 1.17 sec. 2026-03-19 05:52:21 02555_davengers_rename_chain: [ OK ] 3.43 sec. 2026-03-19 05:52:21 01710_minmax_count_projection_constant_query: [ OK ] 0.32 sec. 2026-03-19 05:52:21 02918_gorilla_invalid_file: [ OK ] 0.57 sec. 2026-03-19 05:52:21 03032_scalars_create_as_select: [ OK ] 0.27 sec. 2026-03-19 05:52:21 01796_Log_rwlock_ub: [ OK ] 0.27 sec. 2026-03-19 05:52:22 02039_group_by_with_totals_having: [ OK ] 0.32 sec. 2026-03-19 05:52:22 01098_sum: [ OK ] 0.32 sec. 2026-03-19 05:52:22 02129_window_functions_disable_optimizations: [ OK ] 0.27 sec. 2026-03-19 05:52:22 02351_Map_combinator_dist: [ OK ] 0.42 sec. 2026-03-19 05:52:22 02428_combinators_with_over_statement: [ OK ] 0.32 sec. 2026-03-19 05:52:23 01080_window_view_inner_table_memory_hop: [ OK ] 2.07 sec. 2026-03-19 05:52:23 01685_json_extract_double_as_float: [ OK ] 0.37 sec. 2026-03-19 05:52:23 02476_fuse_sum_count: [ OK ] 0.42 sec. 2026-03-19 05:52:23 01599_multiline_input_and_singleline_comments: [ OK ] 1.12 sec. 2026-03-19 05:52:24 02047_log_family_complex_structs_data_file_dumps: [ OK ] 5.88 sec. 2026-03-19 05:52:24 02999_scalar_subqueries_bug_1: [ OK ] 0.42 sec. 2026-03-19 05:52:24 02110_clickhouse_local_custom_tld: [ OK ] 0.72 sec. 2026-03-19 05:52:24 02565_update_empty_nested: [ OK ] 0.37 sec. 2026-03-19 05:52:24 02994_inconsistent_formatting: [ OK ] 0.37 sec. 2026-03-19 05:52:25 03212_thousand_exceptions: [ OK ] 7.49 sec. 2026-03-19 05:52:25 02141_clickhouse_local_interactive_table: [ OK ] 0.92 sec. 2026-03-19 05:52:25 02784_projections_read_in_order_bug: [ OK ] 0.63 sec. 2026-03-19 05:52:25 01211_optimize_skip_unused_shards_type_mismatch: [ OK ] 0.32 sec. 2026-03-19 05:52:25 01102_distributed_local_in_bug: [ OK ] 0.32 sec. 2026-03-19 05:52:25 01525_select_with_offset_fetch_clause: [ OK ] 0.27 sec. 2026-03-19 05:52:25 01825_type_json_2: [ OK ] 0.47 sec. 2026-03-19 05:52:26 01811_storage_buffer_flush_parameters: [ OK ] 2.73 sec. 2026-03-19 05:52:26 01514_empty_buffer_different_types: [ OK ] 0.37 sec. 2026-03-19 05:52:26 01450_set_null_const: [ OK ] 0.42 sec. 2026-03-19 05:52:26 2026-03-19 05:52:26 Having 1 errors! 429 tests passed. 9 tests skipped. 578.27 s elapsed (Process-7). 2026-03-19 05:52:26 02417_null_variadic_behaviour: [ OK ] 0.62 sec. 2026-03-19 05:52:26 2026-03-19 05:52:26 407 tests passed. 4 tests skipped. 578.70 s elapsed (Process-5). 2026-03-19 05:52:26 02577_keepermap_delete_update: [ OK ] 0.42 sec. 2026-03-19 05:52:26 2026-03-19 05:52:26 Having 1 errors! 423 tests passed. 2 tests skipped. 578.70 s elapsed (Process-8). 2026-03-19 05:52:26 02247_read_bools_as_numbers_json: [ OK ] 5.53 sec. 2026-03-19 05:52:26 2026-03-19 05:52:26 404 tests passed. 3 tests skipped. 578.75 s elapsed (Process-9). 2026-03-19 05:52:28 02550_client_connections_credentials: [ OK ] 12.65 sec. 2026-03-19 05:52:28 2026-03-19 05:52:28 487 tests passed. 9 tests skipped. 580.99 s elapsed (Process-6). 2026-03-19 05:52:34 02661_read_from_archive_zip: [ OK ] 10.25 sec. 2026-03-19 05:52:34 2026-03-19 05:52:34 414 tests passed. 6 tests skipped. 586.98 s elapsed (Process-3). 2026-03-19 05:53:55 02481_async_insert_dedup: [ OK ] 95.42 sec. 2026-03-19 05:53:55 2026-03-19 05:53:55 333 tests passed. 6 tests skipped. 667.04 s elapsed (Process-10). 2026-03-19 05:54:24 01171_mv_select_insert_isolation_long: [ OK ] 118.65 sec. 2026-03-19 05:54:24 2026-03-19 05:54:24 314 tests passed. 2 tests skipped. 696.44 s elapsed (Process-4). 2026-03-19 05:54:34 Running 282 stateless tests (MainProcess). 2026-03-19 05:54:38 03231_restore_user_with_existing_role: [ OK ] 4.13 sec. 2026-03-19 05:54:43 03206_replication_lag_metric: [ OK ] 5.34 sec. 2026-03-19 05:54:44 03198_table_function_directory_path: [ OK ] 0.47 sec. 2026-03-19 05:54:44 03198_dynamic_read_subcolumns: [ OK ] 0.42 sec. 2026-03-19 05:54:44 03168_loop_engine_with_parallel_replicas: [ OK ] 0.32 sec. 2026-03-19 05:54:46 03154_lazy_token_iterator: [ OK ] 1.67 sec. 2026-03-19 05:55:02 03151_unload_index_race: [ OK ] 16.01 sec. 2026-03-19 05:55:02 03147_system_columns_access_checks: [ SKIPPED ] 0.00 sec. 2026-03-19 05:55:02 Reason: not running for current build 2026-03-19 05:55:03 03147_parquet_memory_tracking: [ OK ] 0.72 sec. 2026-03-19 05:55:03 03147_table_function_loop: [ OK ] 0.32 sec. 2026-03-19 05:55:53 03008_deduplication_mv_generates_several_blocks_replicated: [ OK ] 49.47 sec. 2026-03-19 05:55:57 03008_s3_plain_rewritable_fault: [ OK ] 4.08 sec. 2026-03-19 05:56:33 03008_deduplication_several_mv_into_one_table_nonreplicated: [ OK ] 36.68 sec. 2026-03-19 05:57:09 03008_deduplication_insert_several_blocks_nonreplicated: [ OK ] 35.03 sec. 2026-03-19 05:57:57 03008_deduplication_insert_several_blocks_replicated: [ OK ] 48.87 sec. 2026-03-19 05:58:00 03002_part_log_rmt_fetch_merge_error: [ OK ] 2.18 sec. 2026-03-19 05:58:04 03002_part_log_rmt_fetch_mutate_error: [ OK ] 3.98 sec. 2026-03-19 05:58:04 02990_rmt_replica_path_uuid: [ OK ] 0.42 sec. 2026-03-19 05:58:06 02980_dist_insert_readonly_replica: [ OK ] 2.13 sec. 2026-03-19 05:58:08 02973_backup_of_in_memory_compressed: [ OK ] 2.03 sec. 2026-03-19 05:58:51 02962_system_sync_replica_lightweight_from_modifier: [ OK ] 42.60 sec. 2026-03-19 05:58:51 02961_drop_tables: [ OK ] 0.52 sec. 2026-03-19 05:58:52 02960_partition_by_udf: [ OK ] 0.32 sec. 2026-03-19 05:58:56 02944_dynamically_change_filesystem_cache_size: [ OK ] 3.83 sec. 2026-03-19 05:58:59 02943_rmt_alter_metadata_merge_checksum_mismatch: [ OK ] 3.53 sec. 2026-03-19 05:59:00 02931_max_num_to_warn: [ OK ] 0.57 sec. 2026-03-19 05:59:04 02916_move_partition_inactive_replica: [ OK ] 3.73 sec. 2026-03-19 05:59:07 02915_move_partition_inactive_replica: [ OK ] 2.88 sec. 2026-03-19 05:59:07 02911_row_policy_on_cluster: [ OK ] 0.62 sec. 2026-03-19 05:59:07 02910_prefetch_unexpceted_exception: [ OK ] 0.22 sec. 2026-03-19 05:59:08 02908_empty_named_collection: [ OK ] 0.27 sec. 2026-03-19 05:59:11 02908_many_requests_to_system_replicas: [ OK ] 3.33 sec. 2026-03-19 05:59:15 02888_replicated_merge_tree_creation: [ OK ] 3.33 sec. 2026-03-19 05:59:15 02887_insert_quorum_wo_keeper_retries: [ OK ] 0.42 sec. 2026-03-19 05:59:16 02884_async_insert_skip_settings: [ OK ] 0.57 sec. 2026-03-19 05:59:18 02884_async_insert_native_protocol_3: [ OK ] 2.28 sec. 2026-03-19 05:59:30 02874_parquet_multiple_batches_array_inconsistent_offsets: [ OK ] 11.66 sec. 2026-03-19 05:59:39 02871_peak_threads_usage: [ OK ] 9.50 sec. 2026-03-19 05:59:40 02867_create_user_ssh: [ OK ] 0.27 sec. 2026-03-19 05:59:40 02863_delayed_source_with_totals_and_extremes: [ OK ] 0.42 sec. 2026-03-19 05:59:42 02845_threads_count_in_distributed_queries: [ OK ] 1.58 sec. 2026-03-19 05:59:42 02843_insertion_table_schema_infer: [ OK ] 0.77 sec. 2026-03-19 05:59:45 02841_parquet_filter_pushdown: [ OK ] 2.48 sec. 2026-03-19 05:59:45 02833_multiprewhere_extra_column: [ OK ] 0.47 sec. 2026-03-19 05:59:48 02808_filesystem_cache_drop_query: [ OK ] 2.68 sec. 2026-03-19 05:59:49 02796_calculate_text_stack_trace: [ OK ] 1.07 sec. 2026-03-19 05:59:52 02789_filesystem_cache_alignment: [ OK ] 3.03 sec. 2026-03-19 05:59:54 02789_table_functions_errors: [ OK ] 1.37 sec. 2026-03-19 05:59:54 02782_uniq_exact_parallel_merging_bug: [ SKIPPED ] 0.00 sec. 2026-03-19 05:59:54 Reason: not running for current build 2026-03-19 05:59:55 02775_show_columns_called_from_mysql: [ OK ] 0.82 sec. 2026-03-19 05:59:55 02762_replicated_database_no_args: [ OK ] 0.37 sec. 2026-03-19 05:59:56 02751_ip_types_aggregate_functions_states: [ OK ] 0.72 sec. 2026-03-19 05:59:57 02736_reading_and_writing_structure_fields: [ OK ] 1.42 sec. 2026-03-19 05:59:58 02735_capnp_case_insensitive_names_matching: [ OK ] 0.77 sec. 2026-03-19 06:00:02 02735_parquet_encoder: [ OK ] 4.48 sec. 2026-03-19 06:00:03 02725_url_support_virtual_column: [ OK ] 0.37 sec. 2026-03-19 06:00:28 02725_start_stop_fetches: [ OK ] 25.59 sec. 2026-03-19 06:00:29 02710_default_replicated_parameters: [ OK ] 0.32 sec. 2026-03-19 06:00:30 02706_show_columns: [ OK ] 0.72 sec. 2026-03-19 06:00:46 02700_s3_part_INT_MAX: [ OK ] 16.37 sec. 2026-03-19 06:00:46 02581_share_big_sets_between_mutation_tasks_long: [ SKIPPED ] 0.00 sec. 2026-03-19 06:00:46 Reason: not running for current build 2026-03-19 06:00:47 02572_system_logs_materialized_views_ignore_errors: [ OK ] 0.82 sec. 2026-03-19 06:00:49 02566_ipv4_ipv6_binary_formats: [ OK ] 2.68 sec. 2026-03-19 06:00:50 02561_temporary_table_sessions: [ OK ] 0.77 sec. 2026-03-19 06:00:51 02541_arrow_duration_type: [ OK ] 0.77 sec. 2026-03-19 06:01:06 02535_max_parallel_replicas_custom_key_mt: [ OK ] 14.82 sec. 2026-03-19 06:01:20 02535_max_parallel_replicas_custom_key_rmt: [ OK ] 14.31 sec. 2026-03-19 06:01:21 02522_avro_complicate_schema: [ OK ] 0.92 sec. 2026-03-19 06:01:47 02515_cleanup_async_insert_block_ids: [ OK ] 26.20 sec. 2026-03-19 06:01:48 02510_orc_map_indexes: [ OK ] 0.67 sec. 2026-03-19 06:01:50 02503_cache_on_write_with_small_segment_size: [ OK ] 1.68 sec. 2026-03-19 06:01:53 02503_insert_storage_snapshot: [ OK ] 2.78 sec. 2026-03-19 06:01:54 02501_deep_recusion_schema_inference: [ OK ] 1.02 sec. 2026-03-19 06:01:54 02497_trace_events_stress_long: [ SKIPPED ] 0.00 sec. 2026-03-19 06:01:54 Reason: not running for current build 2026-03-19 06:01:54 02495_s3_filter_by_file: [ OK ] 0.67 sec. 2026-03-19 06:01:55 02494_query_cache_user_quotas_after_drop: [ OK ] 0.42 sec. 2026-03-19 06:01:56 02494_query_cache_query_log: [ OK ] 0.98 sec. 2026-03-19 06:01:56 02494_query_cache_case_agnostic_matching: [ OK ] 0.37 sec. 2026-03-19 06:01:56 02494_query_cache_compression: [ OK ] 0.32 sec. 2026-03-19 06:01:57 02494_query_cache_totals_extremes: [ OK ] 0.37 sec. 2026-03-19 06:01:57 02494_query_cache_exception_handling: [ OK ] 0.27 sec. 2026-03-19 06:01:58 02494_query_cache_eligible_queries: [ OK ] 0.42 sec. 2026-03-19 06:02:04 02494_query_cache_ttl_long: [ OK ] 6.34 sec. 2026-03-19 06:02:04 02494_query_cache_events: [ OK ] 0.52 sec. 2026-03-19 06:02:07 02494_trace_log_profile_events: [ OK ] 2.38 sec. 2026-03-19 06:02:07 02494_query_cache_bugs: [ OK ] 0.32 sec. 2026-03-19 06:02:08 02494_query_cache_squash_partial_results: [ OK ] 0.42 sec. 2026-03-19 06:02:08 02484_substitute_udf_storage_args: [ OK ] 0.27 sec. 2026-03-19 06:02:08 02483_check_virtuals_shile_using_structure_from_insertion_table: [ OK ] 0.32 sec. 2026-03-19 06:02:10 02483_capnp_decimals: [ OK ] 1.27 sec. 2026-03-19 06:02:10 02482_new_json_nested_arrays_with_same_keys: [ OK ] 0.77 sec. 2026-03-19 06:02:11 02482_json_nested_arrays_with_same_keys: [ OK ] 0.72 sec. 2026-03-19 06:02:12 02481_custom_separated_and_template_with_csv_field: [ OK ] 1.17 sec. 2026-03-19 06:02:14 02459_glob_for_recursive_directory_traversal: [ OK ] 1.57 sec. 2026-03-19 06:02:14 02458_hdfs_cluster_schema_inference: [ OK ] 0.37 sec. 2026-03-19 06:02:18 02440_mutations_finalization: [ OK ] 3.33 sec. 2026-03-19 06:02:18 02422_msgpack_uuid_wrong_column: [ OK ] 0.32 sec. 2026-03-19 06:02:20 02422_allow_implicit_no_password: [ OK ] 2.38 sec. 2026-03-19 06:02:27 02421_record_errors_row_by_input_format: [ OK ] 6.54 sec. 2026-03-19 06:02:27 02411_merge_tree_zero_max_read_buffer_size: [ OK ] 0.32 sec. 2026-03-19 06:02:28 02404_schema_inference_cache_respect_format_settings: [ OK ] 0.67 sec. 2026-03-19 06:02:28 02397_system_parts_race_condition_drop_rm: [ SKIPPED ] 0.00 sec. 2026-03-19 06:02:28 Reason: disabled 2026-03-19 06:02:28 02396_system_parts_race_condition_rm: [ SKIPPED ] 0.00 sec. 2026-03-19 06:02:28 Reason: disabled 2026-03-19 06:02:28 02391_recursive_buffer: [ OK ] 0.42 sec. 2026-03-19 06:02:29 02385_profile_events_overflow: [ OK ] 0.37 sec. 2026-03-19 06:02:29 02376_arrow_dict_with_string: [ OK ] 0.32 sec. 2026-03-19 06:02:30 02373_heap_buffer_overflow_in_avro: [ OK ] 0.87 sec. 2026-03-19 06:02:30 02352_rwlock: [ SKIPPED ] 0.00 sec. 2026-03-19 06:02:30 Reason: not running for current build 2026-03-19 06:02:31 02350_views_max_insert_threads: [ OK ] 0.62 sec. 2026-03-19 06:02:31 02346_additional_filters_distr: [ OK ] 0.32 sec. 2026-03-19 06:02:33 02337_drop_filesystem_cache_access: [ OK ] 1.57 sec. 2026-03-19 06:02:33 02323_null_modifier_in_table_function: [ OK ] 0.32 sec. 2026-03-19 06:02:33 02313_avro_records_and_maps: [ OK ] 0.37 sec. 2026-03-19 06:02:34 02311_system_zookeeper_insert_priv: [ OK ] 0.92 sec. 2026-03-19 06:02:35 02304_orc_arrow_parquet_string_as_string: [ OK ] 0.32 sec. 2026-03-19 06:02:46 02294_overcommit_overflow: [ OK ] 11.40 sec. 2026-03-19 06:03:11 02286_mysql_dump_input_format: [ OK ] 24.69 sec. 2026-03-19 06:03:13 02262_column_ttl: [ OK ] 1.87 sec. 2026-03-19 06:03:20 02247_written_bytes_quota: [ OK ] 7.29 sec. 2026-03-19 06:03:20 02244_lowcardinality_hash_join: [ OK ] 0.32 sec. 127.0.0.1 - - [18/Mar/2026:16:03:24 +0000] "PUT /devstoreaccount1/cont/rwitsijxfbfxgnguunfylcsdcessirva HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:25 +0000] "PUT /devstoreaccount1/cont/ltfjhhqlndspxqkpbdrddpphqkiingwu HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:25 +0000] "PUT /devstoreaccount1/cont/pyrhjyqfndrsohmkcrnwllaqwbibozxb HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:25 +0000] "PUT /devstoreaccount1/cont/yfcfutjfhzaoshvssgjfhztfuakuktqv HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:25 +0000] "PUT /devstoreaccount1/cont/qxjrjwxxpxgnbiqymiycqepdrmqjaolf HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:25 +0000] "PUT /devstoreaccount1/cont/gnzkiiktdxjubhkdqwvyxnzagbyruitq HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:25 +0000] "PUT /devstoreaccount1/cont/xkpdubhycetwzevsjougnlolrrdtglpv HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:25 +0000] "PUT /devstoreaccount1/cont/hhpjqmbhehukwmefvtcqjpvpikrixldh HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:25 +0000] "PUT /devstoreaccount1/cont/eomclorwtlrozmqerudptbksbesoydsp HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:25 +0000] "PUT /devstoreaccount1/cont/pveigydxgoyijxxldglanimyunrqsxwb HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:25 +0000] "GET /devstoreaccount1/cont/pyrhjyqfndrsohmkcrnwllaqwbibozxb HTTP/1.1" 206 520 127.0.0.1 - - [18/Mar/2026:16:03:25 +0000] "GET /devstoreaccount1/cont/ltfjhhqlndspxqkpbdrddpphqkiingwu HTTP/1.1" 206 808111 127.0.0.1 - - [18/Mar/2026:16:03:26 +0000] "DELETE /devstoreaccount1/cont/pveigydxgoyijxxldglanimyunrqsxwb HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:26 +0000] "DELETE /devstoreaccount1/cont/xkpdubhycetwzevsjougnlolrrdtglpv HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:26 +0000] "DELETE /devstoreaccount1/cont/qxjrjwxxpxgnbiqymiycqepdrmqjaolf HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:26 +0000] "DELETE /devstoreaccount1/cont/ltfjhhqlndspxqkpbdrddpphqkiingwu HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:26 +0000] "DELETE /devstoreaccount1/cont/pyrhjyqfndrsohmkcrnwllaqwbibozxb HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:26 +0000] "DELETE /devstoreaccount1/cont/yfcfutjfhzaoshvssgjfhztfuakuktqv HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:26 +0000] "DELETE /devstoreaccount1/cont/gnzkiiktdxjubhkdqwvyxnzagbyruitq HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:26 +0000] "DELETE /devstoreaccount1/cont/eomclorwtlrozmqerudptbksbesoydsp HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:26 +0000] "DELETE /devstoreaccount1/cont/hhpjqmbhehukwmefvtcqjpvpikrixldh HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:26 +0000] "DELETE /devstoreaccount1/cont/rwitsijxfbfxgnguunfylcsdcessirva HTTP/1.1" 202 - 2026-03-19 06:03:26 02242_system_filesystem_cache_log_table: [ OK ] 5.54 sec. 2026-03-19 06:03:37 02242_delete_user_race: [ OK ] 11.35 sec. 127.0.0.1 - - [18/Mar/2026:16:03:49 +0000] "PUT /devstoreaccount1/cont/gsqbsezfutnmbjprpmzvmlqtpkkgoadr HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:50 +0000] "PUT /devstoreaccount1/cont/frhwsnmhiukqbqudpddwvbayhtficszm HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:50 +0000] "PUT /devstoreaccount1/cont/wlcgaiimshwdziiazsxlpaolgiojyyag HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:50 +0000] "PUT /devstoreaccount1/cont/fvdbizzczmxvzjazuvdzxatwkhalepjc HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:50 +0000] "PUT /devstoreaccount1/cont/iapnxmauijafewvuucfemhekddqvaooe HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:50 +0000] "PUT /devstoreaccount1/cont/kbrvxkybvrosrkhxvtiabfslxfxslcqi HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:50 +0000] "PUT /devstoreaccount1/cont/aivtaayhlkwngtqczptoxirbtlsguwoq HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:50 +0000] "PUT /devstoreaccount1/cont/rbjnbdpiyjjftwsvlpckdxmosrslylbm HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:50 +0000] "PUT /devstoreaccount1/cont/nkrdzxhogzvhvtqfrchdmrweefhiqwpi HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:51 +0000] "PUT /devstoreaccount1/cont/xxwrqqedojegbjhzcalwhrnzhweuvmmp HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:51 +0000] "PUT /devstoreaccount1/cont/tpdymxzhldbplclbatgutrwvwzdjulmc HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:51 +0000] "PUT /devstoreaccount1/cont/toevghoqdckomlprouhcbpxuuguklkrn HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:51 +0000] "PUT /devstoreaccount1/cont/zflezvmexfzzydusvfghcoqomuqghiyb HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:51 +0000] "PUT /devstoreaccount1/cont/ixfbsynsrnuzqfvlmsrpmrjkskrqjpgb HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:51 +0000] "PUT /devstoreaccount1/cont/stlxxcxujryqumonywsujixdavzkhcth HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:51 +0000] "PUT /devstoreaccount1/cont/utsbjwtxfmqxejuftvjykgldbuigyxnf HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:51 +0000] "PUT /devstoreaccount1/cont/llddsjpbdvmbvfojtgdtuzcdqgammtfe HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:52 +0000] "PUT /devstoreaccount1/cont/xdndgcakqjxiqxerxckyqfxmqclcxadd HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:52 +0000] "PUT /devstoreaccount1/cont/sysscaxsewdtogscdvazpwvnqerxmolh HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:52 +0000] "PUT /devstoreaccount1/cont/hhlmaclcbpvqxcxtrpldrnfwcutchztu HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:52 +0000] "PUT /devstoreaccount1/cont/gknqzbehqnxzdralmkrsjhkpyingifec HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:52 +0000] "PUT /devstoreaccount1/cont/qxkgxkejgqytmhzjbapnfqabglyshbpn HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:52 +0000] "PUT /devstoreaccount1/cont/mcfvwmqwjovjyeeyafoeasmxdwwlvbgl HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:52 +0000] "PUT /devstoreaccount1/cont/juiuywduukpmgkcptazocjdvltjkioxg HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:52 +0000] "PUT /devstoreaccount1/cont/suewjyrwdvqeyhmajjaszajcuwtumomx HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:52 +0000] "PUT /devstoreaccount1/cont/qmtenbxgxqudpwejphcmnvvdfntcmcwh HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:52 +0000] "PUT /devstoreaccount1/cont/lkpkhdhxnewpxubwlundgtnrcukrghpp HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:52 +0000] "PUT /devstoreaccount1/cont/qppxrktsycgxfmjtkduguhtykbbrsfve HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:52 +0000] "PUT /devstoreaccount1/cont/ssabiypaiaordcxvakuxombyrsjvqnng HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:52 +0000] "PUT /devstoreaccount1/cont/dafjkmkfwroptghenlakqviddzkuqsml HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:52 +0000] "PUT /devstoreaccount1/cont/vbtqacqkjkcqlrvfcruydxrxewrfxxnu HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:52 +0000] "PUT /devstoreaccount1/cont/gwrlcqrbwethfbiyszckhgdouaghvfkv HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:52 +0000] "PUT /devstoreaccount1/cont/yqdfappiveesqcgqdjcssyhgujinlcor HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/pjaefpngksigdicufflueuyyapiprbkn HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/eqlybugpqmcnmmiabdaavjhwfjfxewrv HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/cqlfvpogmlvewxttwqldztxsncsqhkic HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/efvjrwygxsptfdmbaebhcakrvbxlsbsz HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/wizyfgqayrpxqpbctkwvcmpkfugqyqiz HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/uustbbxuyykdygnsvcibksjkbtsbagby HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/umpskbmxzlvihwtnzmrilwslbuspbumf HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/nlpjckktbfsrnamjqdmtsuzlmaakrbts HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "GET /devstoreaccount1/cont/sysscaxsewdtogscdvazpwvnqerxmolh HTTP/1.1" 206 80 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "GET /devstoreaccount1/cont/frhwsnmhiukqbqudpddwvbayhtficszm HTTP/1.1" 206 746 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "GET /devstoreaccount1/cont/xdndgcakqjxiqxerxckyqfxmqclcxadd HTTP/1.1" 206 746 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/cfmwzwfqqtkwodabpqpnajakiorrpkhi HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/pvcwyelbeekorqhfvzcthidjozdkniii HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/rjubdcycknolyasiqwucaibbqayethju HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/axbjgujcbkoyjrgukkhvtxoeguwnhhhh HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/tfyafwcesgdsuwyddclhqenzglytuikz HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/kcefmnrxyvyimegthyutumfeteslncfr HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/xnyikolnvfsgvbnmttvdftmvccgtqned HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/xykbnwkzqlzbrywifnjccnsejstnbtfw HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/hfrdbzwbhtekyqmrlkcqgffxchjjpkdj HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/wlazvxbvujfobqqhbtfubfhalobyzqss HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/cvocwexjaizmjgjvtzitflfdzaqzcffo HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/quswraopflcwxjwmqksohgwlqimumypz HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/fzebbovjnbeqwnrumruzsxtvlmbiepbw HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/zlrfpupdlnloskrrrgtpsslgzoptigih HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/lczfashgvgsohseinyufcnzfdufswvnu HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/zywqwmnpsvauewcpooygvtpzbzruefgl HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:53 +0000] "PUT /devstoreaccount1/cont/gqntcnkbcvrtdlqfylkrnppbdlhwhnqs HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/xookzbegbxqirrxeqqckveawnmihefks HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/bunogyjjjfmkjssdzfighhvrtddhjewl HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/uxapwixxcldcrqidcxptqydudaugvabr HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/pemwgeferpwkqavjdlutfvpelnwyrcay HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/xfdbsoqgmnyxcjxlwqozghkssrzblztr HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/boxybhqddupcaicbyaenvzlgkpnwavyo HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/rwqrlettrxgclenmqiswlzckobvtsfna HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/urqfimgqgoiipbfwplulcuevtzrtmagw HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/lfddxmjqairdcmyzdcdhkekaqcbuxrlt HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/iwuqirmsorbcicnwcwaaeoqyzngqcgcc HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/rrohlrojjyvgiyhtqxaropwsuoqdijjl HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/crihynfbayiayysuvavrsjlewizcxfkt HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/ifwxkhtutphwfehxbzucgybleqdeijyp HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/jodpeyihhmxaavqjdrrgirolwrtergwo HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/wjofhrxgtsxguwqllxjejyfaymuvczkq HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/qojgvhzakypxmeavlctahycuklebbong HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/pepoqiqvfgxhixtyoskhakqngzrrbjcv HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/rqnirvevypynpfrfoxdnivxyepbkflyi HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/ddqvzzlcvtjuqklnhoonclhrhrhxgvkm HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/gffhtlzhnolhyziqtdtbtrorzsdikcdw HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/vlokbeuauuqrqcblnqwlmqzvudzwtxir HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/skkbayswyootixkobvqyuyeqcaworqgj HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/avfebxdmpdhaxtlzrtpiykphuguefkxw HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/dsdanszgxpsyyedylgohlfuisactasng HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/myhgjbktkzyxqrcdogpopfsvzataxuyv HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/wbjpqharoijbjcsoroejnkptknnvigoc HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/nrtnkmqdfgyhjioqvjremszfvmzjiada HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/khrkbcqxkvbvehimkooxzppbpxyhhudi HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/hilzlfgqvbqdgjlugkwoluyixdomfthb HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/lldmaiwcyuyrznargrgdtgoqdvwpnsky HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/zfxfdiigbfzdzikdaqpsrcbdvyiiadbp HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/qciaoscmuqddsqnixxszisxtxetwrldp HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/wrgukjkgjpwongyvcckrqolpjvzknbof HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/oavczrqzzfxrfqktlvaaepxxyjrqmbyp HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/yrhgjcdkczkmyioseaizvonuioazvhop HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/xoxiikxcvnippcuskqhxzygfnpyvphtz HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/jdkuxutbiqikoupjunsrlfgkyphqyewc HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/mylrisnwgynorcwhypcwnipzjrmqhmzo HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/yfctqdmcpyksyescftzfiyjsuuufjvif HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/qeqxfsjscidphmelaqcbantwzpolzjif HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/cyfyyacfuswgjcvvlqhafaznqqpqnmyo HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/rnbnmznriswgdstymjcmtlrbishrnzdq HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/zyostymjsjjuhfzdfyijkxwwyahlgzjg HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/bqkusnwchwpnadukfhvxlaetjlgdbftm HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/znmklcycdwqakonbngtvqdahmzzfcprn HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/rrhcabywujsxotxtjdfggcushuylokte HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/mruluwfooshtuihyfsmnlwuudbrlmmds HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/oyjwsykqndavfxdjvfvlutzmqulhyicd HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/qragwjiwsuksayrksgnfxxhkegkrvuxx HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:54 +0000] "PUT /devstoreaccount1/cont/tcmqemiioydqsyfwcrvndzqkzfmwmrxi HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "PUT /devstoreaccount1/cont/lkbvwahedzfsqrlqvypzqmmlmalabzga HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "PUT /devstoreaccount1/cont/sipfqneoukmjpillfghyjvbbgzahstek HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "PUT /devstoreaccount1/cont/tgpdxauqsuktkdjsxgkzirpbtevhemlt HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "PUT /devstoreaccount1/cont/cmkofuigiszpekdgbeklikryyvcmgblk HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "PUT /devstoreaccount1/cont/torqdrbeudrbgbcdffoqqlanfqbbtnjj HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "PUT /devstoreaccount1/cont/cfqisyuuzchkhmwpnontdyiohsewbpvs HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "PUT /devstoreaccount1/cont/bifurbmgzzkwpqtfsaeaawsxxchjnqdg HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "PUT /devstoreaccount1/cont/bxaelsirtrkfzxrogiqovkzqzvhjfjqc HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "PUT /devstoreaccount1/cont/aptfbacgqdbubmhxedafsnldosnbfdtx HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "PUT /devstoreaccount1/cont/cxaczzueinkzdkaprdjyrgqsdncvjqgy HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/cxaczzueinkzdkaprdjyrgqsdncvjqgy HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/lkbvwahedzfsqrlqvypzqmmlmalabzga HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/cfqisyuuzchkhmwpnontdyiohsewbpvs HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/sipfqneoukmjpillfghyjvbbgzahstek HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/bifurbmgzzkwpqtfsaeaawsxxchjnqdg HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/torqdrbeudrbgbcdffoqqlanfqbbtnjj HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/tgpdxauqsuktkdjsxgkzirpbtevhemlt HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/cmkofuigiszpekdgbeklikryyvcmgblk HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/aptfbacgqdbubmhxedafsnldosnbfdtx HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/bxaelsirtrkfzxrogiqovkzqzvhjfjqc HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/nkrdzxhogzvhvtqfrchdmrweefhiqwpi HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/kbrvxkybvrosrkhxvtiabfslxfxslcqi HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/iapnxmauijafewvuucfemhekddqvaooe HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/frhwsnmhiukqbqudpddwvbayhtficszm HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/wlcgaiimshwdziiazsxlpaolgiojyyag HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/fvdbizzczmxvzjazuvdzxatwkhalepjc HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/rbjnbdpiyjjftwsvlpckdxmosrslylbm HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/aivtaayhlkwngtqczptoxirbtlsguwoq HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/xykbnwkzqlzbrywifnjccnsejstnbtfw HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/tfyafwcesgdsuwyddclhqenzglytuikz HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/axbjgujcbkoyjrgukkhvtxoeguwnhhhh HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/cfmwzwfqqtkwodabpqpnajakiorrpkhi HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/pvcwyelbeekorqhfvzcthidjozdkniii HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/rjubdcycknolyasiqwucaibbqayethju HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/xnyikolnvfsgvbnmttvdftmvccgtqned HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/kcefmnrxyvyimegthyutumfeteslncfr HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/gqntcnkbcvrtdlqfylkrnppbdlhwhnqs HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/zlrfpupdlnloskrrrgtpsslgzoptigih HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/fzebbovjnbeqwnrumruzsxtvlmbiepbw HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/wlazvxbvujfobqqhbtfubfhalobyzqss HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/cvocwexjaizmjgjvtzitflfdzaqzcffo HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/quswraopflcwxjwmqksohgwlqimumypz HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/zywqwmnpsvauewcpooygvtpzbzruefgl HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/lczfashgvgsohseinyufcnzfdufswvnu HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/llddsjpbdvmbvfojtgdtuzcdqgammtfe HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/ixfbsynsrnuzqfvlmsrpmrjkskrqjpgb HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:55 +0000] "DELETE /devstoreaccount1/cont/zflezvmexfzzydusvfghcoqomuqghiyb HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/xxwrqqedojegbjhzcalwhrnzhweuvmmp HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/tpdymxzhldbplclbatgutrwvwzdjulmc HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/toevghoqdckomlprouhcbpxuuguklkrn HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/utsbjwtxfmqxejuftvjykgldbuigyxnf HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/stlxxcxujryqumonywsujixdavzkhcth HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/suewjyrwdvqeyhmajjaszajcuwtumomx HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/qxkgxkejgqytmhzjbapnfqabglyshbpn HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/gknqzbehqnxzdralmkrsjhkpyingifec HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/xdndgcakqjxiqxerxckyqfxmqclcxadd HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/sysscaxsewdtogscdvazpwvnqerxmolh HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/hhlmaclcbpvqxcxtrpldrnfwcutchztu HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/juiuywduukpmgkcptazocjdvltjkioxg HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/mcfvwmqwjovjyeeyafoeasmxdwwlvbgl HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/yqdfappiveesqcgqdjcssyhgujinlcor HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/dafjkmkfwroptghenlakqviddzkuqsml HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/ssabiypaiaordcxvakuxombyrsjvqnng HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/qmtenbxgxqudpwejphcmnvvdfntcmcwh HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/lkpkhdhxnewpxubwlundgtnrcukrghpp HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/qppxrktsycgxfmjtkduguhtykbbrsfve HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/gwrlcqrbwethfbiyszckhgdouaghvfkv HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/vbtqacqkjkcqlrvfcruydxrxewrfxxnu HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/nlpjckktbfsrnamjqdmtsuzlmaakrbts HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/wizyfgqayrpxqpbctkwvcmpkfugqyqiz HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/efvjrwygxsptfdmbaebhcakrvbxlsbsz HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/pjaefpngksigdicufflueuyyapiprbkn HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/eqlybugpqmcnmmiabdaavjhwfjfxewrv HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/cqlfvpogmlvewxttwqldztxsncsqhkic HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/umpskbmxzlvihwtnzmrilwslbuspbumf HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/uustbbxuyykdygnsvcibksjkbtsbagby HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/iwuqirmsorbcicnwcwaaeoqyzngqcgcc HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/xookzbegbxqirrxeqqckveawnmihefks HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/boxybhqddupcaicbyaenvzlgkpnwavyo HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/bunogyjjjfmkjssdzfighhvrtddhjewl HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/rwqrlettrxgclenmqiswlzckobvtsfna HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/xfdbsoqgmnyxcjxlwqozghkssrzblztr HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/uxapwixxcldcrqidcxptqydudaugvabr HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/pemwgeferpwkqavjdlutfvpelnwyrcay HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/lfddxmjqairdcmyzdcdhkekaqcbuxrlt HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/urqfimgqgoiipbfwplulcuevtzrtmagw HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/gffhtlzhnolhyziqtdtbtrorzsdikcdw HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/rrohlrojjyvgiyhtqxaropwsuoqdijjl HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/qojgvhzakypxmeavlctahycuklebbong HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/crihynfbayiayysuvavrsjlewizcxfkt HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/pepoqiqvfgxhixtyoskhakqngzrrbjcv HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/wjofhrxgtsxguwqllxjejyfaymuvczkq HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/ifwxkhtutphwfehxbzucgybleqdeijyp HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/jodpeyihhmxaavqjdrrgirolwrtergwo HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/ddqvzzlcvtjuqklnhoonclhrhrhxgvkm HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/rqnirvevypynpfrfoxdnivxyepbkflyi HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/lldmaiwcyuyrznargrgdtgoqdvwpnsky HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/vlokbeuauuqrqcblnqwlmqzvudzwtxir HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/wbjpqharoijbjcsoroejnkptknnvigoc HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/skkbayswyootixkobvqyuyeqcaworqgj HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/nrtnkmqdfgyhjioqvjremszfvmzjiada HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/myhgjbktkzyxqrcdogpopfsvzataxuyv HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/avfebxdmpdhaxtlzrtpiykphuguefkxw HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/dsdanszgxpsyyedylgohlfuisactasng HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/hilzlfgqvbqdgjlugkwoluyixdomfthb HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/khrkbcqxkvbvehimkooxzppbpxyhhudi HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/qeqxfsjscidphmelaqcbantwzpolzjif HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/zfxfdiigbfzdzikdaqpsrcbdvyiiadbp HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/xoxiikxcvnippcuskqhxzygfnpyvphtz HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/qciaoscmuqddsqnixxszisxtxetwrldp HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/jdkuxutbiqikoupjunsrlfgkyphqyewc HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/yrhgjcdkczkmyioseaizvonuioazvhop HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/wrgukjkgjpwongyvcckrqolpjvzknbof HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/oavczrqzzfxrfqktlvaaepxxyjrqmbyp HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/yfctqdmcpyksyescftzfiyjsuuufjvif HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/mylrisnwgynorcwhypcwnipzjrmqhmzo HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/tcmqemiioydqsyfwcrvndzqkzfmwmrxi HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/cyfyyacfuswgjcvvlqhafaznqqpqnmyo HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/rrhcabywujsxotxtjdfggcushuylokte HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/rnbnmznriswgdstymjcmtlrbishrnzdq HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/mruluwfooshtuihyfsmnlwuudbrlmmds HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/znmklcycdwqakonbngtvqdahmzzfcprn HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/zyostymjsjjuhfzdfyijkxwwyahlgzjg HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/bqkusnwchwpnadukfhvxlaetjlgdbftm HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/qragwjiwsuksayrksgnfxxhkegkrvuxx HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/oyjwsykqndavfxdjvfvlutzmqulhyicd HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/gsqbsezfutnmbjprpmzvmlqtpkkgoadr HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:03:56 +0000] "DELETE /devstoreaccount1/cont/hfrdbzwbhtekyqmrlkcqgffxchjjpkdj HTTP/1.1" 202 - 2026-03-19 06:03:56 02241_filesystem_cache_on_write_operations: [ OK ] 17.92 sec. 2026-03-19 06:03:56 02240_filesystem_cache_bypass_cache_threshold: [ OK ] 0.27 sec. 2026-03-19 06:03:56 02240_filesystem_query_cache: [ OK ] 0.22 sec. 127.0.0.1 - - [18/Mar/2026:16:04:02 +0000] "PUT /devstoreaccount1/cont/qiivjkhohefoihemidyuoegapvnyctza HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:02 +0000] "PUT /devstoreaccount1/cont/zhnpzqsxseameaarwkmmvnotvfekvzoq HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:02 +0000] "PUT /devstoreaccount1/cont/lzwazhysyaufjjwkpaizseapctkrjunj HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:02 +0000] "PUT /devstoreaccount1/cont/mgkheywtegoocfexplgbtyhfacchixpv HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:02 +0000] "PUT /devstoreaccount1/cont/dkcxikdbayrmsvrohvdgupenuoksxjtn HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:02 +0000] "PUT /devstoreaccount1/cont/jnjiiajvbfydembqwxbomtfcjdgtzmat HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:02 +0000] "PUT /devstoreaccount1/cont/mzaokcbjytnqosucppuspapdcdrfksxh HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:02 +0000] "PUT /devstoreaccount1/cont/iyjsdmwedpgzpieiwbtpttjwkbwtbmqk HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:02 +0000] "PUT /devstoreaccount1/cont/wbbmvekwgejdkyibhzpwvckjdhszrrjy HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:02 +0000] "PUT /devstoreaccount1/cont/vgpxgcbeerklirhwnmgsjopsloprxtqq HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:02 +0000] "GET /devstoreaccount1/cont/lzwazhysyaufjjwkpaizseapctkrjunj HTTP/1.1" 206 80 127.0.0.1 - - [18/Mar/2026:16:04:02 +0000] "GET /devstoreaccount1/cont/zhnpzqsxseameaarwkmmvnotvfekvzoq HTTP/1.1" 206 746 127.0.0.1 - - [18/Mar/2026:16:04:03 +0000] "GET /devstoreaccount1/cont/lzwazhysyaufjjwkpaizseapctkrjunj HTTP/1.1" 206 80 127.0.0.1 - - [18/Mar/2026:16:04:03 +0000] "GET /devstoreaccount1/cont/zhnpzqsxseameaarwkmmvnotvfekvzoq HTTP/1.1" 206 746 127.0.0.1 - - [18/Mar/2026:16:04:04 +0000] "DELETE /devstoreaccount1/cont/vgpxgcbeerklirhwnmgsjopsloprxtqq HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:04 +0000] "DELETE /devstoreaccount1/cont/mzaokcbjytnqosucppuspapdcdrfksxh HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:04 +0000] "DELETE /devstoreaccount1/cont/dkcxikdbayrmsvrohvdgupenuoksxjtn HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:04 +0000] "DELETE /devstoreaccount1/cont/zhnpzqsxseameaarwkmmvnotvfekvzoq HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:04 +0000] "DELETE /devstoreaccount1/cont/lzwazhysyaufjjwkpaizseapctkrjunj HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:04 +0000] "DELETE /devstoreaccount1/cont/mgkheywtegoocfexplgbtyhfacchixpv HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:04 +0000] "DELETE /devstoreaccount1/cont/jnjiiajvbfydembqwxbomtfcjdgtzmat HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:04 +0000] "DELETE /devstoreaccount1/cont/wbbmvekwgejdkyibhzpwvckjdhszrrjy HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:04 +0000] "DELETE /devstoreaccount1/cont/iyjsdmwedpgzpieiwbtpttjwkbwtbmqk HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:04 +0000] "DELETE /devstoreaccount1/cont/qiivjkhohefoihemidyuoegapvnyctza HTTP/1.1" 202 - 2026-03-19 06:04:04 02240_system_filesystem_cache_table: [ OK ] 7.44 sec. 2026-03-19 06:04:04 02232_dist_insert_send_logs_level_hung: [ SKIPPED ] 0.00 sec. 2026-03-19 06:04:04 Reason: disabled 2026-03-19 06:04:05 02227_test_create_empty_sqlite_db: [ OK ] 1.42 sec. 127.0.0.1 - - [18/Mar/2026:16:04:09 +0000] "PUT /devstoreaccount1/cont/ugxmtmdisaobpyxupndbrrgrrsrxjdfn HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:09 +0000] "PUT /devstoreaccount1/cont/cigcntkdruubzcbsukkjgfwamxldumqb HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:09 +0000] "PUT /devstoreaccount1/cont/lzbmhlpskkeemjwmpggvxafxsiummjtj HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:09 +0000] "PUT /devstoreaccount1/cont/myddedfsmxnwfdsxjjurzjpalgsiivcb HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:09 +0000] "PUT /devstoreaccount1/cont/danvqkvlwlaqshakkfgqounmlnfzvqwo HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:09 +0000] "PUT /devstoreaccount1/cont/ufzidnltgrhzlmbkqfqzkbvbewcycivw HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:09 +0000] "PUT /devstoreaccount1/cont/ioajbovoquketjiuzxiokhjhoghwwkru HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:09 +0000] "PUT /devstoreaccount1/cont/rxatolslkawizwwbmmtcmbbefekgawhw HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:09 +0000] "PUT /devstoreaccount1/cont/zztcarrjlbeqznwlvoahksasljqqwlgu HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:09 +0000] "PUT /devstoreaccount1/cont/wcehuhbfvmaaqpzemxnuililcjchhgnr HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:09 +0000] "GET /devstoreaccount1/cont/lzbmhlpskkeemjwmpggvxafxsiummjtj HTTP/1.1" 206 62 127.0.0.1 - - [18/Mar/2026:16:04:09 +0000] "GET /devstoreaccount1/cont/cigcntkdruubzcbsukkjgfwamxldumqb HTTP/1.1" 206 101074 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "PUT /devstoreaccount1/cont/gakmbqmhyeqsgihfxpmohtvxsgixsayb HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "PUT /devstoreaccount1/cont/pwjprzandgnarzbnaecdqiuiascknbkz HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "PUT /devstoreaccount1/cont/qvwavlskqrwuvkquzguefwqeblcxckqs HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "PUT /devstoreaccount1/cont/wknwgcwurezftrieddwymltxvahtjcxb HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "PUT /devstoreaccount1/cont/szntyzdnpjbmfewhszsmyxbhdjqszhzn HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/wcehuhbfvmaaqpzemxnuililcjchhgnr HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/ioajbovoquketjiuzxiokhjhoghwwkru HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/danvqkvlwlaqshakkfgqounmlnfzvqwo HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/lzbmhlpskkeemjwmpggvxafxsiummjtj HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/cigcntkdruubzcbsukkjgfwamxldumqb HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/myddedfsmxnwfdsxjjurzjpalgsiivcb HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/ufzidnltgrhzlmbkqfqzkbvbewcycivw HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/zztcarrjlbeqznwlvoahksasljqqwlgu HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/rxatolslkawizwwbmmtcmbbefekgawhw HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "PUT /devstoreaccount1/cont/qgjfkeuhrrxgpwdspfvzvtfkuwaubtjo HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "PUT /devstoreaccount1/cont/osykgpbyvieiynmcvmexkrkeykiyxmmp HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "PUT /devstoreaccount1/cont/buqkwyzeqtmoqnuflsucmsrzfmzpefyv HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "PUT /devstoreaccount1/cont/edfuascbscrelalzqayfafnhexeuamaq HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "PUT /devstoreaccount1/cont/phingavvpharjelhsthwihrgbmgkkwpf HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "PUT /devstoreaccount1/cont/cwoqcuhlvyhgwhferdhxdgcfihieendz HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "PUT /devstoreaccount1/cont/zbdqvzhjdwoomcmvxbkmmquckfdmlitp HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "PUT /devstoreaccount1/cont/eedglefdhtraevuofbgchbsgmcbofpkq HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "PUT /devstoreaccount1/cont/ubcbcwmoxvngvwhtnovesgnojtawajqh HTTP/1.1" 201 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/szntyzdnpjbmfewhszsmyxbhdjqszhzn HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/pwjprzandgnarzbnaecdqiuiascknbkz HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/gakmbqmhyeqsgihfxpmohtvxsgixsayb HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/haycyvmhfqfvhalanmklemprqfshkgpb HTTP/1.1" 404 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/ijoxxkmanaczxlsmusrperpwofwsahuf HTTP/1.1" 404 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/nbwhiqpwzajhbougunzueqkhausxrnzq HTTP/1.1" 404 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/wknwgcwurezftrieddwymltxvahtjcxb HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/qvwavlskqrwuvkquzguefwqeblcxckqs HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/ubcbcwmoxvngvwhtnovesgnojtawajqh HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/cwoqcuhlvyhgwhferdhxdgcfihieendz HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/edfuascbscrelalzqayfafnhexeuamaq HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/osykgpbyvieiynmcvmexkrkeykiyxmmp HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/qgjfkeuhrrxgpwdspfvzvtfkuwaubtjo HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/buqkwyzeqtmoqnuflsucmsrzfmzpefyv HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/phingavvpharjelhsthwihrgbmgkkwpf HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/eedglefdhtraevuofbgchbsgmcbofpkq HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/zbdqvzhjdwoomcmvxbkmmquckfdmlitp HTTP/1.1" 202 - 127.0.0.1 - - [18/Mar/2026:16:04:11 +0000] "DELETE /devstoreaccount1/cont/ugxmtmdisaobpyxupndbrrgrrsrxjdfn HTTP/1.1" 202 - 2026-03-19 06:04:11 02226_filesystem_cache_profile_events: [ OK ] 5.89 sec. 2026-03-19 06:04:12 02225_unwinder_dwarf_version: [ OK ] 0.92 sec. 2026-03-19 06:04:15 02222_create_table_without_columns_metadata: [ OK ] 3.38 sec. 2026-03-19 06:04:18 02207_allow_plaintext_and_no_password: [ OK ] 2.58 sec. 2026-03-19 06:04:20 02185_values_schema_inference: [ OK ] 1.82 sec. 2026-03-19 06:04:21 02184_ipv6_parsing: [ OK ] 1.27 sec. 2026-03-19 06:04:22 02182_json_each_row_schema_inference: [ OK ] 0.92 sec. 2026-03-19 06:04:23 02179_dict_reload_on_cluster: [ OK ] 0.52 sec. 2026-03-19 06:04:23 02177_temporary_table_current_database_http_session: [ OK ] 0.62 sec. 2026-03-19 06:04:24 02168_avro_bug: [ OK ] 0.32 sec. 2026-03-19 06:04:25 02166_arrow_dictionary_inference: [ OK ] 1.07 sec. 2026-03-19 06:04:25 02155_multiple_inserts_for_formats_with_suffix: [ OK ] 0.42 sec. 2026-03-19 06:04:25 02148_sql_user_defined_function_subquery: [ OK ] 0.37 sec. 2026-03-19 06:04:26 02126_identity_user_defined_function: [ OK ] 0.32 sec. 2026-03-19 06:04:26 02125_recursive_sql_user_defined_functions: [ OK ] 0.42 sec. 2026-03-19 06:04:26 02125_many_mutations_2: [ SKIPPED ] 0.00 sec. 2026-03-19 06:04:26 Reason: not running for current build 2026-03-19 06:04:28 02105_table_function_file_partiotion_by: [ OK ] 1.57 sec. 2026-03-19 06:04:29 02104_json_strings_nullable_string: [ OK ] 1.07 sec. 2026-03-19 06:04:29 02103_sql_user_defined_functions_composition: [ OK ] 0.32 sec. 2026-03-19 06:04:36 02103_tsv_csv_custom_null_representation: [ OK ] 6.24 sec. 2026-03-19 06:04:36 02101_sql_user_defined_functions_drop_if_exists: [ OK ] 0.32 sec. 2026-03-19 06:04:36 02098_sql_user_defined_functions_aliases: [ OK ] 0.37 sec. 2026-03-19 06:04:37 02096_sql_user_defined_function_alias: [ OK ] 0.32 sec. 2026-03-19 06:04:37 02096_rename_atomic_hang: [ OK ] 0.37 sec. 2026-03-19 06:04:39 02051_read_settings: [ OK ] 1.58 sec. 2026-03-19 06:04:39 02028_add_default_database_for_alterquery_on_cluster: [ OK ] 0.77 sec. 2026-03-19 06:04:49 02026_storage_filelog_largefile: [ OK ] 9.25 sec. 2026-03-19 06:04:49 02025_dictionary_view_different_db: [ OK ] 0.37 sec. 2026-03-19 06:04:49 02015_column_default_dict_get_identifier: [ OK ] 0.37 sec. 2026-03-19 06:04:51 02015_global_in_threads: [ OK ] 1.52 sec. 2026-03-19 06:04:51 02011_dictionary_empty_attribute_list: [ OK ] 0.32 sec. 2026-03-19 06:04:52 01999_grant_with_replace: [ OK ] 0.37 sec. 2026-03-19 06:04:52 01948_dictionary_quoted_database_name: [ OK ] 0.37 sec. 2026-03-19 06:04:52 01915_create_or_replace_dictionary: [ OK ] 0.37 sec. 2026-03-19 06:04:53 01913_exact_rows_before_limit_full: [ OK ] 0.37 sec. 2026-03-19 06:04:53 01910_view_dictionary: [ OK ] 0.42 sec. 2026-03-19 06:04:54 01903_ssd_cache_dictionary_array_type: [ OK ] 0.92 sec. 2026-03-19 06:04:55 01902_table_function_merge_db_repr: [ OK ] 0.47 sec. 2026-03-19 06:04:56 01901_test_attach_partition_from: [ OK ] 0.92 sec. 2026-03-19 06:04:57 01889_postgresql_protocol_null_fields: [ OK ] 0.92 sec. 2026-03-19 06:04:57 01870_buffer_flush: [ OK ] 0.38 sec. 2026-03-19 06:04:57 01856_create_function: [ OK ] 0.42 sec. 2026-03-19 06:04:59 01853_dictionary_cache_duplicates: [ OK ] 1.57 sec. 2026-03-19 06:05:00 01850_dist_INSERT_preserve_error: [ OK ] 0.42 sec. 2026-03-19 06:05:00 01837_database_memory_ddl_dictionaries: [ OK ] 0.37 sec. 2026-03-19 06:05:00 01821_table_comment: [ OK ] 0.37 sec. 2026-03-19 06:05:01 01785_dictionary_element_count: [ OK ] 0.52 sec. 2026-03-19 06:05:01 01778_hierarchical_dictionaries: [ OK ] 0.57 sec. 2026-03-19 06:05:02 01754_direct_dictionary_complex_key: [ OK ] 0.77 sec. 2026-03-19 06:05:03 01753_direct_dictionary_simple_key: [ OK ] 0.87 sec. 2026-03-19 06:05:04 01747_executable_pool_dictionary_implicit_key: [ OK ] 1.07 sec. 2026-03-19 06:05:05 01746_executable_pool_dictionary: [ OK ] 1.17 sec. 2026-03-19 06:05:07 01737_clickhouse_server_wait_server_pool_long: [ OK ] 1.98 sec. 2026-03-19 06:05:09 01722_long_brotli_http_compression_json_format: [ OK ] 1.62 sec. 2026-03-19 06:05:09 01721_engine_file_truncate_on_insert: [ OK ] 0.32 sec. 2026-03-19 06:05:14 01710_projection_vertical_merges: [ OK ] 4.28 sec. 2026-03-19 06:05:14 01681_cache_dictionary_simple_key: [ OK ] 0.62 sec. 2026-03-19 06:05:15 01676_dictget_in_default_expression: [ OK ] 0.42 sec. 2026-03-19 06:05:15 01670_dictionary_create_key_expression: [ OK ] 0.37 sec. 2026-03-19 06:05:16 01646_system_restart_replicas_smoke: [ OK ] 0.42 sec. 2026-03-19 06:05:17 01643_replicated_merge_tree_fsync_smoke: [ OK ] 1.43 sec. 2026-03-19 06:05:18 01615_random_one_shard_insertion: [ OK ] 0.57 sec. 2026-03-19 06:05:18 01603_rename_overwrite_bug: [ OK ] 0.42 sec. 2026-03-19 06:05:41 01600_detach_permanently: [ OK ] 23.35 sec. 2026-03-19 06:06:26 01593_concurrent_alter_mutations_kill_many_replicas_long: [ OK ] 44.16 sec. 2026-03-19 06:06:26 01575_disable_detach_table_of_dictionary: [ OK ] 0.27 sec. 2026-03-19 06:06:26 01530_drop_database_atomic_sync: [ OK ] 0.57 sec. 2026-03-19 06:06:27 01527_clickhouse_local_optimize: [ OK ] 0.82 sec. 2026-03-19 06:06:28 01526_complex_key_dict_direct_layout: [ OK ] 0.42 sec. 2026-03-19 06:06:29 01524_do_not_merge_across_partitions_select_final: [ OK ] 0.97 sec. 2026-03-19 06:06:29 01517_drop_mv_with_inner_table: [ OK ] 0.42 sec. 2026-03-19 06:06:32 01507_clickhouse_server_start_with_embedded_config: [ OK ] 2.53 sec. 2026-03-19 06:06:33 01501_cache_dictionary_all_fields: [ OK ] 1.07 sec. 2026-03-19 06:06:35 01474_executable_dictionary: [ OK ] 2.13 sec. 2026-03-19 06:06:36 01471_calculate_ttl_during_merge: [ OK ] 0.47 sec. 2026-03-19 06:06:49 01459_manual_write_to_replicas_quorum_detach_attach: [ OK ] 13.26 sec. 2026-03-19 06:06:49 01459_manual_write_to_replicas: [ SKIPPED ] 0.00 sec. 2026-03-19 06:06:49 Reason: not running for current build 2026-03-19 06:06:49 01457_create_as_table_function_structure: [ OK ] 0.42 sec. 2026-03-19 06:06:50 01455_rank_correlation_spearman: [ OK ] 0.37 sec. 2026-03-19 06:07:11 01454_storagememory_data_race_challenge: [ OK ] 21.38 sec. 2026-03-19 06:07:15 01417_freeze_partition_verbose_zookeeper: [ OK ] 3.48 sec. 2026-03-19 06:07:21 01417_freeze_partition_verbose: [ OK ] 6.19 sec. 2026-03-19 06:08:04 01414_mutations_and_errors_zookeeper: [ OK ] 43.61 sec. 2026-03-19 06:08:06 01410_nullable_key_more_tests: [ OK ] 1.73 sec. 2026-03-19 06:08:10 01375_storage_file_tsv_csv_with_names_write_prefix: [ OK ] 4.13 sec. 2026-03-19 06:08:12 01360_materialized_view_with_join_on_query_log: [ OK ] 1.93 sec. 2026-03-19 06:08:13 01356_view_threads: [ OK ] 0.57 sec. 2026-03-19 06:08:24 01320_create_sync_race_condition_zookeeper: [ OK ] 10.85 sec. 2026-03-19 06:08:27 01307_multiple_leaders_zookeeper: [ OK ] 3.73 sec. 2026-03-19 06:08:39 01305_replica_create_drop_zookeeper: [ OK ] 11.10 sec. 2026-03-19 06:09:11 01301_aggregate_state_exception_memory_leak: [ OK ] 32.78 sec. 2026-03-19 06:09:12 01297_create_quota: [ OK ] 0.72 sec. 2026-03-19 06:09:13 01295_create_row_policy: [ OK ] 0.42 sec. 2026-03-19 06:09:13 01294_system_distributed_on_cluster: [ OK ] 0.52 sec. 2026-03-19 06:09:14 01294_create_settings_profile: [ OK ] 0.52 sec. 2026-03-19 06:09:14 01293_system_distribution_queue: [ OK ] 0.42 sec. 2026-03-19 06:09:15 01281_unsucceeded_insert_select_queries_counter: [ OK ] 0.42 sec. 2026-03-19 06:09:19 01281_group_by_limit_memory_tracking: [ OK ] 4.13 sec. 2026-03-19 06:09:22 01280_ssd_complex_key_dictionary: [ OK ] 2.83 sec. 2026-03-19 06:10:10 01275_parallel_mv: [ OK ] 48.47 sec. 2026-03-19 06:10:11 01251_dict_is_in_infinite_loop: [ OK ] 0.52 sec. 2026-03-19 06:10:11 01225_show_create_table_from_dictionary: [ OK ] 0.32 sec. 2026-03-19 06:10:44 01192_rename_database_zookeeper: [ OK ] 33.32 sec. 2026-03-19 06:10:45 01164_alter_memory_database: [ OK ] 0.37 sec. 2026-03-19 06:10:45 01155_rename_move_materialized_view: [ OK ] 0.73 sec. 2026-03-19 06:11:43 01154_move_partition_long: [ OK ] 57.34 sec. 2026-03-19 06:11:43 01153_attach_mv_uuid: [ OK ] 0.52 sec. 2026-03-19 06:11:44 01148_zookeeper_path_macros_unfolding: [ OK ] 0.87 sec. 2026-03-19 06:11:45 01119_weird_user_names: [ OK ] 0.32 sec. 2026-03-19 06:12:13 01111_create_drop_replicated_db_stress: [ OK ] 28.91 sec. 2026-03-19 06:12:14 01110_dictionary_layout_without_arguments: [ OK ] 0.27 sec. 2026-03-19 06:12:14 01103_distributed_product_mode_local_column_renames: [ OK ] 0.62 sec. 2026-03-19 06:12:21 01098_temporary_and_external_tables: [ OK ] 6.99 sec. 2026-03-19 06:12:22 01091_num_threads: [ OK ] 0.72 sec. 2026-03-19 06:12:24 01085_max_distributed_connections_http: [ OK ] 1.68 sec. 2026-03-19 06:12:57 01083_expressions_in_engine_arguments: [ OK ] 32.68 sec. 2026-03-19 06:12:58 01082_window_view_watch_limit: [ OK ] 1.07 sec. 2026-03-19 06:13:23 01079_parallel_alter_detach_table_zookeeper: [ OK ] 25.50 sec. 2026-03-19 06:13:30 01076_cache_dictionary_datarace_exception_ptr: [ OK ] 6.69 sec. 2026-03-19 06:13:30 01075_allowed_client_hosts: [ OK ] 0.27 sec. 2026-03-19 06:13:35 01075_window_view_proc_tumble_to_now_populate: [ OK ] 4.94 sec. 2026-03-19 06:13:36 01070_materialize_ttl: [ OK ] 0.72 sec. 2026-03-19 06:13:37 01070_mutations_with_dependencies: [ OK ] 0.72 sec. 2026-03-19 06:13:37 01070_modify_ttl: [ OK ] 0.72 sec. 2026-03-19 06:13:47 01069_window_view_proc_tumble_watch: [ OK ] 9.20 sec. 2026-03-19 06:13:48 01065_window_view_event_hop_watch_bounded: [ OK ] 1.22 sec. 2026-03-19 06:13:49 01060_shutdown_table_after_detach: [ OK ] 1.02 sec. 2026-03-19 06:13:55 01055_window_view_proc_hop_to: [ OK ] 6.24 sec. 2026-03-19 06:13:58 01053_ssd_dictionary: [ OK ] 2.33 sec. 2026-03-19 06:14:04 01038_dictionary_lifetime_min_zero_sec: [ OK ] 6.04 sec. 2026-03-19 06:14:04 01036_no_superfluous_dict_reload_on_create_database: [ OK ] 0.37 sec. 2026-03-19 06:14:04 01036_no_superfluous_dict_reload_on_create_database_2: [ OK ] 0.42 sec. 2026-03-19 06:14:05 01023_materialized_view_query_context: [ OK ] 0.42 sec. 2026-03-19 06:14:17 01018_ddl_dictionaries_concurrent_requrests: [ OK ] 11.85 sec. 2026-03-19 06:14:19 01018_ddl_dictionaries_bad_queries: [ OK ] 2.63 sec. 2026-03-19 06:14:42 01014_lazy_database_concurrent_recreate_reattach_and_show_tables: [ OK ] 22.99 sec. 2026-03-19 06:14:58 01014_lazy_database_basic: [ OK ] 15.42 sec. 2026-03-19 06:15:00 01013_sync_replica_timeout_zookeeper: [ OK ] 2.53 sec. 2026-03-19 06:15:12 01007_r1r2_w_r2r1_deadlock: [ OK ] 11.80 sec. 2026-03-19 06:15:25 01004_rename_deadlock: [ OK ] 12.87 sec. 2026-03-19 06:15:26 00985_merge_stack_overflow: [ OK ] 0.77 sec. 2026-03-19 06:15:27 00971_query_id_in_logs: [ OK ] 0.92 sec. 2026-03-19 06:15:27 00963_achimbab: [ OK ] 0.32 sec. 2026-03-19 06:15:28 00950_dict_get: [ OK ] 0.92 sec. 2026-03-19 06:15:30 00877_memory_limit_for_new_delete: [ OK ] 1.93 sec. 2026-03-19 06:15:30 00840_long_concurrent_select_and_drop_deadlock: [ SKIPPED ] 0.00 sec. 2026-03-19 06:15:30 Reason: not running for current build 2026-03-19 06:15:30 00722_inner_join: [ OK ] 0.37 sec. 2026-03-19 06:15:31 00693_max_block_size_system_tables_columns: [ OK ] 0.47 sec. 2026-03-19 06:15:34 00623_truncate_table_throw_exception: [ OK ] 3.18 sec. 2026-03-19 06:15:35 00510_materizlized_view_and_deduplication_zookeeper: [ OK ] 0.82 sec. 2026-03-19 06:15:43 00463_long_sessions_in_http_interface: [ OK ] 8.45 sec. 2026-03-19 06:15:44 00332_quantile_timing_memory_leak: [ OK ] 0.32 sec. 2026-03-19 06:15:44 00309_formats_case_insensitive: [ OK ] 0.37 sec. 2026-03-19 06:15:44 00002_log_and_exception_messages_formatting: [ SKIPPED ] 0.00 sec. 2026-03-19 06:15:44 Reason: skip 2026-03-19 06:15:44 2026-03-19 06:15:44 270 tests passed. 12 tests skipped. 1270.66 s elapsed (MainProcess). 2026-03-19 06:15:45 Won't run stateful tests because test data wasn't loaded. 2026-03-19 06:15:45 Checking the hung queries: done 2026-03-19 06:15:45 2026-03-19 06:15:45 No queries hung. 2026-03-19 06:15:45 2026-03-19 06:15:45 Some tests were restarted: 2026-03-19 06:15:45 2026-03-19 06:15:45 2026-03-19 06:15:45 02221_parallel_replicas_bug : 2026-03-19 06:15:45 [ fail ] 3.03 sec. 2026-03-19 06:15:45 Reason: having stderror: 2026-03-19 06:15:45 [47cadafda42e] 2026.03.18 17:49:04.781037 [ 37259 ] {e1529c7a-72ff-4fc3-bb72-3af11b0dfc0b} ConnectionPoolWithFailover: Connection failed at try №1, reason: Code: 210. DB::NetException: Connection refused (127.0.0.3:1234). (NETWORK_ERROR) (version 24.8.14.10526.altinitytest (altinity build)) 2026-03-19 06:15:45 2026-03-19 06:15:45 stdout: 2026-03-19 06:15:45 2026-03-19 06:15:45 2026-03-19 06:15:45 Settings used in the test: --max_insert_threads 3 --group_by_two_level_threshold 590457 --group_by_two_level_threshold_bytes 9189731 --distributed_aggregation_memory_efficient 0 --fsync_metadata 0 --output_format_parallel_formatting 1 --input_format_parallel_parsing 1 --min_chunk_bytes_for_parallel_parsing 5510708 --max_read_buffer_size 1048414 --prefer_localhost_replica 0 --max_block_size 94179 --max_joined_block_size_rows 36003 --max_threads 3 --optimize_append_index 0 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 1 --optimize_read_in_order 0 --optimize_or_like_chain 1 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 76 --optimize_aggregation_in_order 0 --aggregation_in_order_max_block_bytes 48204531 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 1294731199 --min_bytes_to_use_mmap_io 1 --local_filesystem_read_method io_uring --remote_filesystem_read_method threadpool --local_filesystem_read_prefetch 0 --filesystem_cache_segments_batch_size 50 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 0 --remote_filesystem_read_prefetch 0 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 64Mi --filesystem_prefetches_limit 10 --filesystem_prefetch_min_bytes_for_single_read_task 16Mi --filesystem_prefetch_step_marks 0 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 1 --compile_sort_description 0 --merge_tree_coarse_index_granularity 26 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 10737418240 --max_bytes_before_external_group_by 0 --max_bytes_before_remerge_sort 2432962475 --min_compress_block_size 1997095 --max_compress_block_size 360083 --merge_tree_compact_parts_min_granules_to_multibuffer_read 57 --optimize_sorting_by_input_stream_properties 1 --http_response_buffer_size 2461337 --http_wait_end_of_query False --enable_memory_bound_merging_of_aggregation_results 0 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 3 --session_timezone Africa/Khartoum --use_page_cache_for_disks_without_file_cache False --page_cache_inject_eviction False --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.77 --prefer_external_sort_block_bytes 100000000 --cross_join_min_rows_to_compress 1 --cross_join_min_bytes_to_compress 1 --min_external_table_block_size_bytes 0 --max_parsing_threads 10 --optimize_functions_to_subcolumns 0 --parallel_replicas_local_plan 0 2026-03-19 06:15:45 2026-03-19 06:15:45 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 0.0 --prefer_fetch_merged_part_size_threshold 2513233833 --vertical_merge_algorithm_min_rows_to_activate 1 --vertical_merge_algorithm_min_columns_to_activate 100 --allow_vertical_merges_from_compact_to_wide_parts 0 --min_merge_bytes_to_use_direct_io 1 --index_granularity_bytes 10520334 --merge_max_block_size 7818 --index_granularity 64036 --min_bytes_for_wide_part 0 --marks_compress_block_size 16259 --primary_key_compress_block_size 65604 --replace_long_file_name_to_hash 1 --max_file_name_length 81 --min_bytes_for_full_part_storage 381396411 --compact_parts_max_bytes_to_buffer 320806723 --compact_parts_max_granules_to_buffer 255 --compact_parts_merge_max_bytes_to_prefetch_part 13186141 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 86 --old_parts_lifetime 108 2026-03-19 06:15:45 2026-03-19 06:15:45 Database: test_7umr486f 2026-03-19 06:15:45 All tests have finished. 2026-03-19 06:15:45 2026-03-19 06:15:45 Top patterns of log messages: 2026-03-19 06:15:45 2026-03-19 06:15:45 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string 2026-03-19 06:15:45 2026-03-19 06:15:45 1. 234235 0.074 10.45 MiB 0.033 1 1352 ['Trace'] 1 is disk {} eligible for search: {} 2026-03-19 06:15:45 2. 128003 0.04 25.04 MiB 0.078 1 311 ['Debug'] 0 (from {}{}{}){}{} {} (stage: {}) 2026-03-19 06:15:45 3. 127929 0.04 19.16 MiB 0.06 40311 308 ['Trace'] 1 {} Creating query context from {} context, user_id: {}, parent context user: {} 2026-03-19 06:15:45 4. 114932 0.036 2.75 MiB 0.009 1 772 ['Trace'] 0.001 Query to stage {}{} 2026-03-19 06:15:45 5. 113523 0.036 5.34 MiB 0.017 1 771 ['Trace'] 0.001 Query from stage {} to stage {}{} 2026-03-19 06:15:45 6. 109511 0.034 4.79 MiB 0.015 1 1 ['Trace'] 1 Processing requests batch, size: {}, bytes: {} 2026-03-19 06:15:45 7. 104325 0.033 2.87 MiB 0.009 1 264 ['Debug'] 0 Processed in {} sec. 2026-03-19 06:15:45 8. 74524 0.023 5.90 MiB 0.018 1 291 ['Debug'] 0 Read {} rows, {} in {} sec., {} rows/sec., {}/sec. 2026-03-19 06:15:45 9. 74460 0.023 2.40 MiB 0.007 1 1538 ['Trace'] 0 Aggregation method: {} 2026-03-19 06:15:45 10. 69910 0.022 6.25 MiB 0.019 1 1533 ['Trace'] 0 Aggregated. {} to {} rows (from {}) in {} sec. ({:.3f} rows/sec., {}/sec.) 2026-03-19 06:15:45 11. 64864 0.02 4.45 MiB 0.014 1 2016 ['Trace'] 0.516 Reserved {} on local disk {}, having unreserved {}. 2026-03-19 06:15:45 12. 60970 0.019 6.79 MiB 0.021 2830 1522 ['Trace'] 0.395 Renaming temporary part {} to {} with tid {}. 2026-03-19 06:15:45 13. 57636 0.018 3.90 MiB 0.012 2818 2011 ['Trace'] 0.474 Trying to reserve {} using storage policy from min volume index {} 2026-03-19 06:15:45 14. 56940 0.018 611.66 KiB 0.002 1 1531 ['Trace'] 0 Aggregating 2026-03-19 06:15:45 15. 54723 0.017 4.32 MiB 0.013 1 1505 ['Trace'] 0 An entry for key={} found in cache: sum_of_sizes={}, median_size={} 2026-03-19 06:15:45 16. 49884 0.016 3.85 MiB 0.012 1605 331 ['Trace'] 0 Reading {} ranges in{}order from part {}, approx. {} rows starting from {} 2026-03-19 06:15:45 17. 45045 0.014 2.03 MiB 0.006 1 1511 ['Trace'] 0.141 filled checksums {} 2026-03-19 06:15:45 18. 42192 0.013 1.97 MiB 0.006 1 305 ['Debug'] 0.213 Peak memory usage{}: {}. 2026-03-19 06:15:45 19. 40928 0.013 1.85 MiB 0.006 40928 458 ['Debug'] 0.996 Authenticating user '{}' from {} 2026-03-19 06:15:45 20. 40899 0.013 4.49 MiB 0.014 40899 458 ['Debug'] 0.996 {} Authenticated with global context as user {} 2026-03-19 06:15:45 21. 40850 0.013 3.51 MiB 0.011 40850 452 ['Debug'] 0.996 {} Logout, user_id: {} 2026-03-19 06:15:45 22. 40490 0.013 2.90 MiB 0.009 40490 308 ['Debug'] 1 Creating session context with user_id: {} 2026-03-19 06:15:45 23. 38905 0.012 8.22 MiB 0.026 3 284 ['Trace'] 1 HTTP Request for {}. Method: {}, Address: {}, User-Agent: {}{}, Content Type: {}, Transfer Encoding: {}, X-Forwarded-For: {} 2026-03-19 06:15:45 24. 38896 0.012 21.60 MiB 0.067 2 284 ['Trace'] 1 Request URI: {} 2026-03-19 06:15:45 25. 36759 0.012 753.85 KiB 0.002 2 284 ['Debug'] 0.442 Done processing query 2026-03-19 06:15:45 26. 34062 0.011 2.99 MiB 0.009 444 525 ['Trace'] 0.998 Insert entry {} to queue with type {} 2026-03-19 06:15:45 27. 32077 0.01 2.45 MiB 0.008 737 1836 ['Trace'] 0.942 Part {} is not stored on zero-copy replicated disk, blobs can be removed 2026-03-19 06:15:45 28. 28429 0.009 2.36 MiB 0.007 871 512 ['Trace'] 1 Scheduling next merge selecting task after {}ms, current attempt status: {} 2026-03-19 06:15:45 29. 28024 0.009 3.81 MiB 0.012 654 512 ['Trace'] 1 Checked {} partitions, found {} partitions with parts that may be merged: [{}] (max_total_size_to_merge={}, merge_with_ttl_allowed={}) 2026-03-19 06:15:45 30. 26012 0.008 2.61 MiB 0.008 267 33 ['Debug'] 1 Fetching part {} from {}:{} 2026-03-19 06:15:45 31. 25610 0.008 1.44 MiB 0.004 444 525 ['Debug'] 0.998 Pulling {} entries to queue: {} - {} 2026-03-19 06:15:45 32. 25610 0.008 650.30 KiB 0.002 444 525 ['Debug'] 0.998 Pulled {} entries to queue. 2026-03-19 06:15:45 33. 25558 0.008 2.29 MiB 0.007 1 125 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part 2026-03-19 06:15:45 34. 25452 0.008 748.19 KiB 0.002 1760 393 ['Debug'] 0.004 Key condition: {} 2026-03-19 06:15:45 35. 25248 0.008 3.05 MiB 0.01 1 2 ['Trace'] 1 Creating part at path {} 2026-03-19 06:15:45 36. 23554 0.007 529.04 KiB 0.002 1 1440 ['Trace'] 0 Merging aggregated data 2026-03-19 06:15:45 37. 22612 0.007 993.69 KiB 0.003 1755 393 ['Trace'] 0.005 Filtering marks by primary and secondary keys 2026-03-19 06:15:45 38. 22345 0.007 2.49 MiB 0.008 1748 393 ['Debug'] 0.005 Selected {}/{} parts by partition key, {} parts by primary key, {}/{} marks by primary key, {} marks to read from {} ranges 2026-03-19 06:15:45 39. 20552 0.006 1.04 MiB 0.003 1521 385 ['Trace'] 0.005 Spreading mark ranges among streams (default reading) 2026-03-19 06:15:45 40. 20519 0.006 777.70 KiB 0.002 356 35 ['Debug'] 0.789 Committing part {} to zookeeper 2026-03-19 06:15:45 41. 20141 0.006 658.66 KiB 0.002 2 266 ['Trace'] 1 TCP Request. Address: {} 2026-03-19 06:15:45 42. 20139 0.006 1.90 MiB 0.006 1 266 ['Debug'] 1 Connected {} version {}.{}.{}, revision: {}{}{}. 2026-03-19 06:15:45 43. 20065 0.006 529.06 KiB 0.002 1 260 ['Debug'] 1 Done processing connection. 2026-03-19 06:15:45 44. 19732 0.006 727.09 KiB 0.002 353 32 ['Debug'] 0.82 Part {} committed to zookeeper 2026-03-19 06:15:45 45. 18293 0.006 1.54 MiB 0.005 266 40 ['Trace'] 1 Trying to fetch with zero-copy replication, but disk is not provided, will try to select 2026-03-19 06:15:45 46. 18293 0.006 660.94 KiB 0.002 266 40 ['Trace'] 1 Checking disk {} with type {} 2026-03-19 06:15:45 47. 16271 0.005 352.82 KiB 0.001 219 65 ['Trace'] 1 Sending part {} 2026-03-19 06:15:45 48. 16265 0.005 316.27 KiB 0.001 265 41 ['Debug'] 1 Downloading files {} 2026-03-19 06:15:45 49. 16262 0.005 1.35 MiB 0.004 265 41 ['Trace'] 1 Disk for fetch is not provided, getting disk from reservation {} with type '{}' 2026-03-19 06:15:45 50. 16258 0.005 717.71 KiB 0.002 262 41 ['Debug'] 1 Downloading part {} onto disk {}. 2026-03-19 06:15:45 51. 16255 0.005 860.44 KiB 0.003 262 41 ['Debug'] 1 Download of part {} onto disk {} finished. 2026-03-19 06:15:45 52. 16179 0.005 1.56 MiB 0.005 265 33 ['Debug'] 1 Fetched part {} from {}:{}{} 2026-03-19 06:15:45 53. 16166 0.005 1.01 MiB 0.003 80 488 ['Debug'] 1 There is no part {} in ZooKeeper, it was only in filesystem 2026-03-19 06:15:45 54. 14239 0.004 1.69 MiB 0.005 4050 16 ['Trace'] 1 Executing log entry to merge parts {} to {} 2026-03-19 06:15:45 55. 13531 0.004 475.71 KiB 0.001 1 45 ['Trace'] 1 Keeper request. Address: {} 2026-03-19 06:15:45 56. 12995 0.004 1002.54 KiB 0.003 1 261 ['Trace'] 0 Query span trace_id for opentelemetry log: {} 2026-03-19 06:15:45 57. 12582 0.004 1.32 MiB 0.004 1 75 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part, column {} 2026-03-19 06:15:45 58. 12338 0.004 734.98 KiB 0.002 3579 291 ['Debug'] 0.011 There are {} detached tables. Start searching non used tables. 2026-03-19 06:15:45 59. 12338 0.004 518.10 KiB 0.002 3579 291 ['Debug'] 0.011 Found {} non used tables in detached tables. 2026-03-19 06:15:45 60. 11934 0.004 2.41 MiB 0.008 2002 16 ['Debug'] 1 Don't have all parts (at least {} is missing) for merge {}; will try to fetch it instead. Either pool for fetches is starving, see background_fetches_pool_size, or none of active replicas has it 2026-03-19 06:15:45 61. 11601 0.004 464.49 KiB 0.001 187 556 ['Debug'] 0.587 Will use old analyzer to prepare mutation 2026-03-19 06:15:45 62. 11598 0.004 362.44 KiB 0.001 1 21 ['Debug'] 1 Receive four letter command {} 2026-03-19 06:15:45 63. 9667 0.003 890.33 KiB 0.003 16 23 ['Debug'] 0 Waiting for currently running merges ({} parts are merging right now) to perform OPTIMIZE FINAL 2026-03-19 06:15:45 64. 9118 0.003 725.88 KiB 0.002 1 1401 ['Trace'] 0 Statistics updated for key={}: new sum_of_sizes={}, median_size={} 2026-03-19 06:15:45 65. 8609 0.003 1.14 MiB 0.004 1 222 ['Trace'] 0.018 PREWHERE condition was split into {} steps: {} 2026-03-19 06:15:45 66. 8343 0.003 293.31 KiB 0.001 1 1077 ['Trace'] 0.008 Converting aggregated data to blocks 2026-03-19 06:15:45 67. 8307 0.003 880.96 KiB 0.003 1 1068 ['Debug'] 0.005 Converted aggregated data to blocks. {} rows, {} in {} sec. ({:.3f} rows/sec., {}/sec.) 2026-03-19 06:15:45 68. 7981 0.003 485.26 KiB 0.001 39 32 ['Debug'] 1 Part {} is rendered obsolete by fetching part {} 2026-03-19 06:15:45 69. 7955 0.003 296.68 KiB 0.001 334 247 ['Debug'] 0.011 Reading approx. {} rows with {} streams 2026-03-19 06:15:45 70. 7800 0.002 510.35 KiB 0.002 75 24 ['Information'] 1 Fetching of part was cancelled 2026-03-19 06:15:45 71. 7371 0.002 287.93 KiB 0.001 1 1373 ['Debug'] 0.5 Spawn loader worker #{} in {} 2026-03-19 06:15:45 72. 7371 0.002 208.75 KiB 0.001 1 1342 ['Debug'] 1 Stop worker in {} 2026-03-19 06:15:45 73. 7371 0.002 541.89 KiB 0.002 1 1175 ['Debug'] 1 Execute load job '{}' in {} 2026-03-19 06:15:45 74. 7371 0.002 513.09 KiB 0.002 1 1175 ['Debug'] 1 Finish load job '{}' with status {} 2026-03-19 06:15:45 75. 7371 0.002 563.48 KiB 0.002 1 200 ['Debug'] 0.001 Schedule load job '{}' into {} 2026-03-19 06:15:45 76. 7370 0.002 685.77 KiB 0.002 1 200 ['Debug'] 0 Prioritize load job '{}': {} -> {} 2026-03-19 06:15:45 77. 7343 0.002 64.54 KiB 0 2 200 ['Trace'] 0.001 No tables 2026-03-19 06:15:45 78. 7322 0.002 243.11 KiB 0.001 1 1373 ['Debug'] 0.5 Change current priority: {} -> {} 2026-03-19 06:15:45 79. 7305 0.002 214.01 KiB 0.001 866 524 ['Debug'] 0.993 Updating strategy picker state 2026-03-19 06:15:45 80. 7082 0.002 240.38 KiB 0.001 369 194 ['Debug'] 0.001 MinMax index condition: {} 2026-03-19 06:15:45 81. 6922 0.002 205.02 KiB 0.001 251 1127 ['Trace'] 0.009 Found (RIGHT) boundary mark: {} 2026-03-19 06:15:45 82. 6922 0.002 480.98 KiB 0.001 251 1127 ['Trace'] 0.009 Running binary search on index range for part {} ({} marks) 2026-03-19 06:15:45 83. 6922 0.002 197.71 KiB 0.001 251 1127 ['Trace'] 0.009 Found (LEFT) boundary mark: {} 2026-03-19 06:15:45 84. 6922 0.002 211.65 KiB 0.001 251 1127 ['Trace'] 0.009 Found {} range {}in {} steps 2026-03-19 06:15:45 85. 6743 0.002 326.29 KiB 0.001 680 646 ['Debug'] 0.884 Selected {} parts from {} to {} 2026-03-19 06:15:45 86. 6610 0.002 1.29 MiB 0.004 1 1352 ['Information'] 1 Removing metadata {} of dropped table {} 2026-03-19 06:15:45 87. 6608 0.002 490.44 KiB 0.001 1 216 ['Debug'] 0 Waiting for table {} to be finally dropped 2026-03-19 06:15:45 88. 6608 0.002 761.47 KiB 0.002 1 216 ['Debug'] 0 Done waiting for the table {} to be dropped. The outcome: {} 2026-03-19 06:15:45 89. 6556 0.002 815.24 KiB 0.002 9 511 ['Debug'] 1 Not executing log entry {} of type {} for part {} because merges and mutations are cancelled now. 2026-03-19 06:15:45 90. 6228 0.002 450.09 KiB 0.001 1 512 ['Information'] 1 Have {} tables in drop queue ({} of them are in use), will try drop {} tables 2026-03-19 06:15:45 91. 5802 0.002 1.10 MiB 0.003 1 293 ['Trace'] 0.001 {}Keys: {}, datatype: {}, kind: {}, strictness: {}, right header: {} 2026-03-19 06:15:45 92. 5658 0.002 406.82 KiB 0.001 421 630 ['Debug'] 0 Wrote block with ID '{}', {} rows{} 2026-03-19 06:15:45 93. 5334 0.002 419.24 KiB 0.001 1 139 ['Debug'] 0 Merging {} parts: from {} to {} into {} with storage {} 2026-03-19 06:15:45 94. 5334 0.002 182.14 KiB 0.001 1 139 ['Debug'] 0 Selected MergeAlgorithm: {} 2026-03-19 06:15:45 95. 5316 0.002 686.74 KiB 0.002 1 139 ['Debug'] 0 Merge sorted {} rows, containing {} columns ({} merged, {} gathered) in {} sec., {} rows/sec., {}/sec. 2026-03-19 06:15:45 96. 5301 0.002 311.20 KiB 0.001 523 139 ['Trace'] 0 Merged {} parts: [{}, {}] -> {} 2026-03-19 06:15:45 97. 5286 0.002 384.20 KiB 0.001 1 243 ['Trace'] 0.011 The min valid primary key position for moving to the tail of PREWHERE is {} 2026-03-19 06:15:45 98. 5275 0.002 672.03 KiB 0.002 2300 1547 ['Debug'] 0.976 Removing {} parts from filesystem (serially): Parts: [{}] 2026-03-19 06:15:45 99. 5253 0.002 307.32 KiB 0.001 18 18 ['Trace'] 1 Flushing system log, {} entries to flush up to offset {} 2026-03-19 06:15:45 100. 5252 0.002 191.28 KiB 0.001 18 18 ['Trace'] 1 Flushed system log up to offset {} 2026-03-19 06:15:45 2026-03-19 06:15:45 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string 2026-03-19 06:15:45 2026-03-19 06:15:45 2026-03-19 06:15:45 2026-03-19 06:15:45 Top messages without format string (fmt::runtime): 2026-03-19 06:15:45 2026-03-19 06:15:45 count pattern runtime_message line 2026-03-19 06:15:45 2026-03-19 06:15:45 1. 1618 IfthesignaturecheckfailedThiscou If the signature check failed. This could be because of a time skew. Attempting to adjust the signer. ('/AWSLogger.cpp',71) 2026-03-19 06:15:45 2. 48 CodeDBExceptionSyntaxerrorfailed Code: 62. DB::Exception: Syntax error: failed at position 11 ('#'): #. Unrecognized token: '#'. (SYNTAX_ERROR) (version 24.8.14.10526.altinitytest (altinity build)) (from [::ffff:127.0.0.1]:35572) (comment: 02192_comment_error.sh) (in query: select 42 #), ('/executeQuery.cpp',221) 2026-03-19 06:15:45 3. 10 CodeDBExceptionReceivedfromDBExc Code: 516. DB::Exception: Received from 127.0.0.2:9000. DB::Exception: default: Authentication failed: password is incorrect, or there is no user with such name. 2026-03-19 06:15:45 2026-03-19 06:15:45 If you have installed ClickHouse and forgot password you can reset it in the configuration fi ('/executeQuery.cpp',221) 2026-03-19 06:15:45 4. 8 CodeCoordinationExceptionFaultin Code: 999. Coordination::Exception: Fault injection before operation. (KEEPER_EXCEPTION) (version 24.8.14.10526.altinitytest (altinity build)) (from [::1]:34296) (comment: 02456_keeper_retries_during_insert.sql) (in query: INSERT INTO keeper_retries_r1 SET ('/executeQuery.cpp',221) 2026-03-19 06:15:45 5. 8 CodeDBExceptionReceivedfromlocal Code: 242. DB::Exception: Received from localhost:9000. DB::Exception: Table is in readonly mode: replica_path=/tables/shard_1/data/replicas/read. Stack trace: 2026-03-19 06:15:45 2026-03-19 06:15:45 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String ('/executeQuery.cpp',221) 2026-03-19 06:15:45 6. 4 CodeDBExceptionTherequestsignatu Code: 499. DB::Exception: The request signature we calculated does not match the signature you provided. Check your key and signing method. (S3_ERROR) (version 24.8.14.10526.altinitytest (altinity build)) (from [::1]:52042) (comment: 02843_backup_use_same_ ('/executeQuery.cpp',221) 2026-03-19 06:15:45 7. 4 CodeDBExceptionExpectedargumento Code: 395. DB::Exception: Expected argument of data type real: while executing 'FUNCTION throwIf(_CAST(true_Bool, 'Bool'_String) :: 1, 'Expected argument of data type real'_String :: 2) -> throwIf(_CAST(true_Bool, 'Bool'_String), 'Expected argument of data ('/executeQuery.cpp',221) 2026-03-19 06:15:45 8. 4 CodeDBExceptionEmptyqueryInscope Code: 62. DB::Exception: Empty query: In scope SELECT formatQuery(''). (SYNTAX_ERROR) (version 24.8.14.10526.altinitytest (altinity build)) (from [::1]:54722) (comment: 02882_formatQuery.sql) (in query: SELECT formatQuery('');), Stack trace (when copying t ('/executeQuery.cpp',221) 2026-03-19 06:15:45 9. 2 CodeDBExceptionBadURIsyntaxURIco Code: 1000. DB::Exception: Bad URI syntax: URI contains invalid characters. (POCO_EXCEPTION), Stack trace (when copying this message, always include the lines below): 2026-03-19 06:15:45 2026-03-19 06:15:45 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::URISyntaxException::U ('/TCPHandler.cpp',765) 2026-03-19 06:15:45 10. 2 CodeDBExceptionThereisnosubtypef Code: 386. DB::Exception: There is no subtype for types String, UInt8 because some of them are String/FixedString and some of them are not: In scope SELECT ['1', '2'] AS arr1, [1, 2] AS arr2, round(arrayJaccardIndex(arr1, arr2), 2). (NO_COMMON_TYPE) (versi ('/executeQuery.cpp',221) 2026-03-19 06:15:45 11. 2 CodeDBExceptionEmptyquerySYNTAXE Code: 62. DB::Exception: Empty query. (SYNTAX_ERROR) (version 24.8.14.10526.altinitytest (altinity build)) (from [::ffff:127.0.0.1]:54816) (in query: ), Stack trace (when copying this message, always include the lines below): 2026-03-19 06:15:45 2026-03-19 06:15:45 0. /build/contrib/llvm-projec ('/executeQuery.cpp',221) 2026-03-19 06:15:45 12. 2 PocoExceptionCodeecodeBadURIsynt Poco::Exception. Code: 1000, e.code() = 0, Bad URI syntax: URI contains invalid characters (version 24.8.14.10526.altinitytest (altinity build)) (from [::1]:54556) (comment: 00746_sql_fuzzy.sh) (in query: SELECT * FROM gcs('\0', '\0');), Stack trace (when ('/executeQuery.cpp',221) 2026-03-19 06:15:45 13. 2 CodeDBExceptionFailedtogetobject Code: 499. DB::Exception: Failed to get object info: No response body.. HTTP response code: 404: while reading test: The table structure cannot be extracted from a CSV format file. You can specify the structure manually. (S3_ERROR) (version 24.8.14.10526.a ('/executeQuery.cpp',221) 2026-03-19 06:15:45 14. 2 CodeDBExceptionOutofmemoryalloca Code: 173. DB::Exception: Out of memory: allocation of size 80003648 failed: (in file/uri /var/lib/clickhouse/user_files/03147_parquet_memory_tracking.parquet): While executing ParquetBlockInputFormat: While executing File. (CANNOT_ALLOCATE_MEMORY) (versio ('/executeQuery.cpp',221) 2026-03-19 06:15:45 15. 1 RaftASIOlistenerinitiatedonunsec Raft ASIO listener initiated on :::9234, unsecured ('/LoggerWrapper.h',43) 2026-03-19 06:15:45 16. 1 FailedtomakebackupShttplocalhost Failed to make backup S3('http://localhost:11111/test/backups/test_7xpuiajg/use_same_s3_credentials_for_base_backup_base_inc_3_bad', 'test', '[HIDDEN]'): Code: 499. DB::Exception: The request signature we calculated does not match the signature you provide ('/Exception.cpp',273) 2026-03-19 06:15:45 17. 1 numberofpendingcommitelements number of pending commit elements: 0 ('/LoggerWrapper.h',43) 2026-03-19 06:15:45 18. 1 statemachinecommitindexprecommit state machine commit index 0, precommit index 0, last log index 0 ('/LoggerWrapper.h',43) 2026-03-19 06:15:45 19. 1 Forkedachildprocesstowatch Forked a child process to watch ('',0) 2026-03-19 06:15:45 20. 1 BECOMELEADERappendednewconfigat [BECOME LEADER] appended new config at 1 ('/LoggerWrapper.h',43) 2026-03-19 06:15:45 21. 1 PRIORITYdecaytargetmine [PRIORITY] decay, target 1 -> 1, mine 1 ('/LoggerWrapper.h',43) 2026-03-19 06:15:45 22. 1 parameterselectiontimeoutrangehe parameters: election timeout range 0 - 0, heartbeat 0, leadership expiry 0, max batch 100, backoff 50, snapshot distance 100000, enable randomized snapshot creation NO, log sync stop gap 99999, reserved logs 2147483647, client timeout 10000, auto forwardin ('/LoggerWrapper.h',43) 2026-03-19 06:15:45 23. 1 globalmanagerdoesnotexistwilluse global manager does not exist. will use local thread for commit and append ('/LoggerWrapper.h',43) 2026-03-19 06:15:45 24. 1 newelectiontimeoutrange new election timeout range: 0 - 0 ('/LoggerWrapper.h',43) 2026-03-19 06:15:45 25. 1 snapshotidxlogtermcreatedcompact snapshot idx 100000 log_term 1 created, compact the log store if needed ('/LoggerWrapper.h',43) 2026-03-19 06:15:45 26. 1 CodeDBExceptionavroExceptionCann Code: 1001. DB::Exception: avro::Exception: Cannot read compressed data, expected at least 4 bytes, got 0. (STD_EXCEPTION), Stack trace (when copying this message, always include the lines below): 2026-03-19 06:15:45 2026-03-19 06:15:45 0. /build/contrib/llvm-project/libcxx/include/exception:14 ('/TCPHandler.cpp',765) 2026-03-19 06:15:45 27. 1 newconfigurationlogidxprevlogidx new configuration: log idx 1, prev log idx 0 2026-03-19 06:15:45 peer 1, DC ID 0, localhost:9234, voting member, 1 2026-03-19 06:15:45 my id: 1, leader: 1, term: 1 ('/LoggerWrapper.h',43) 2026-03-19 06:15:45 28. 1 FailedtorestorefrombackupShttplo Failed to restore from backup S3('http://localhost:11111/test/backups/test_7xpuiajg/use_same_s3_credentials_for_base_backup_base_inc_1', 'test', '[HIDDEN]'): Code: 499. DB::Exception: The request signature we calculated does not match the signature you pro ('/Exception.cpp',273) 2026-03-19 06:15:45 29. 1 waitforHBforms wait for HB, for 50 + [0, 0] ms ('/LoggerWrapper.h',43) 2026-03-19 06:15:50 30. 1 stdexceptionCodetypeavroExceptio std::exception. Code: 1001, type: avro::Exception, e.what() = Cannot read compressed data, expected at least 4 bytes, got 0 (version 24.8.14.10526.altinitytest (altinity build)) (from [::1]:45340) (comment: 02373_heap_buffer_overflow_in_avro.sh) (in query: ('/executeQuery.cpp',221) 2026-03-19 06:15:50 2026-03-19 06:15:50 2026-03-19 06:15:50 2026-03-19 06:15:50 Top messages not matching their format strings: 2026-03-19 06:15:50 2026-03-19 06:15:50 message_format_string count() any_message 2026-03-19 06:15:50 2026-03-19 06:15:50 1. 1650 Forked a child process to watch 2026-03-19 06:15:50 message_format_string count() any_message 2026-03-19 06:15:50 2026-03-19 06:15:50 2. Illegal UTF-8 sequence, while processing '{}' 12 Code: 36. DB::Exception: Illegal UTF-8 sequence, while processing '�': while executing 'FUNCTION stringJaccardIndexUTF8(materialize('hello'_String) :: 3, materialize('�'_String) :: 1) -> stringJaccardIndexUTF8(materialize('hello'_String), materialize('�'_String)) Float64 : 2'. (BAD_ARGUMENTS) (version 24.8.14.10526.altinitytest (altinity build)) (from [::1]:40690) (comment: 02884_string_distance_function.sql) (in query: SELECT stringJaccardIndexUTF8(materialize('hello'), materialize('\xC2\x01'));), Stack trace (when copying this message, always include the lines below): 2026-03-19 06:15:50 2026-03-19 06:15:50 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x00000000164a0872 2026-03-19 06:15:50 1. /build/src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000000c652179 2026-03-19 06:15:50 2. /build/contrib/llvm-project/libcxx/include/string:1499: DB::Exception::Exception(PreformattedMessage&&, int) @ 0x000000000701116c 2026-03-19 06:15:50 3. /build/contrib/llvm-project/libcxx/include/vector:438: DB::Exception::Exception(int, FormatStringHelperImpl::type>, StringRef&&) @ 0x0000000007af8fcb 2026-03-19 06:15:50 4. /build/src/Functions/FunctionsStringDistance.cpp:0: DB::parseUTF8String(char const*, unsigned long, std::function, std::function) @ 0x0000000007af881c 2026-03-19 06:15:50 5. /build/contrib/llvm-project/libcxx/include/__functional/function.h:818: ? @ 0x0000000007b027b7 2026-03-19 06:15:50 6. /build/src/Common/PODArray.h:208: DB::FunctionStringDistanceImpl>::vectorVector(DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul>&, unsigned long) @ 0x0000000007b023cf 2026-03-19 06:15:50 7. /build/src/Functions/FunctionsStringSimilarity.h:0: DB::FunctionsStringSimilarity>, DB::NameJaccardIndexUTF8>::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x0000000007b01c2f 2026-03-19 06:15:50 8. /build/src/Functions/IFunctionAdaptors.h:22: DB::FunctionToExecutableFunctionAdaptor::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000702697a 2026-03-19 06:15:50 9. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b69ca5 2026-03-19 06:15:50 10. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b6a71a 2026-03-19 06:15:50 11. /build/src/Functions/IFunction.cpp:0: DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b6b645 2026-03-19 06:15:50 12. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::ExpressionActions::execute(DB::Block&, unsigned long&, bool, bool) const @ 0x00000000111abdfd 2026-03-19 06:15:50 13. /build/src/Processors/Transforms/ExpressionTransform.cpp:0: DB::ExpressionTransform::transform(DB::Chunk&) @ 0x0000000012fc9316 2026-03-19 06:15:50 14. /build/contrib/llvm-project/libcxx/include/__utility/swap.h:35: DB::ISimpleTransform::transform(DB::Chunk&, DB::Chunk&) @ 0x000000000c90c4f3 2026-03-19 06:15:50 15. /build/src/Processors/ISimpleTransform.cpp:99: DB::ISimpleTransform::work() @ 0x0000000012d6c0e9 2026-03-19 06:15:50 16. /build/src/Processors/Executors/ExecutionThreadContext.cpp:0: DB::ExecutionThreadContext::executeTask() @ 0x0000000012d86909 2026-03-19 06:15:50 17. /build/src/Processors/Executors/PipelineExecutor.cpp:273: DB::PipelineExecutor::executeStepImpl(unsigned long, std::atomic*) @ 0x0000000012d7c5b0 2026-03-19 06:15:50 18. /build/contrib/llvm-project/libcxx/include/vector:547: DB::PipelineExecutor::executeSingleThread(unsigned long) @ 0x0000000012d7c83d 2026-03-19 06:15:50 19. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: DB::PipelineExecutor::executeImpl(unsigned long, bool) @ 0x0000000012d7b6ac 2026-03-19 06:15:50 20. /build/contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:274: DB::PipelineExecutor::execute(unsigned long, bool) @ 0x0000000012d7b0c5 2026-03-19 06:15:50 21. /build/src/Processors/Executors/PullingAsyncPipelineExecutor.cpp:0: void std::__function::__policy_invoker::__call_impl::ThreadFromGlobalPoolImpl(DB::PullingAsyncPipelineExecutor::pull(DB::Chunk&, unsigned long)::$_0&&)::'lambda'(), void ()>>(std::__function::__policy_storage const*) @ 0x0000000012d8978a 2026-03-19 06:15:50 22. /build/base/base/../base/wide_integer_impl.h:817: ThreadPoolImpl::ThreadFromThreadPool::worker() @ 0x000000000c706d2e 2026-03-19 06:15:50 23. /build/contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: void* std::__thread_proxy[abi:v15007]>, void (ThreadPoolImpl::ThreadFromThreadPool::*)(), ThreadPoolImpl::ThreadFromThreadPool*>>(void*) @ 0x000000000c70c192 2026-03-19 06:15:50 24. ? @ 0x00007fac68332ac3 2026-03-19 06:15:50 25. ? @ 0x00007fac683c4850 2026-03-19 06:15:50 2026-03-19 06:15:50 message_format_string count() any_message 2026-03-19 06:15:50 2026-03-19 06:15:50 3. Close WriteBufferFromAzureBlobStorage. {}. 4 Close WriteBufferFromAzureBlobStorage. gsqbsezfutnmbjprpmzvmlqtpkkgoadr. (LogSeriesLimiter: on interval from 2026-03-19 06:03:24 to 2026-03-19 06:03:49 accepted series 1 / 10 for the logger WriteBufferFromAzureBlobStorage) 2026-03-19 06:15:50 message_format_string count() any_message 2026-03-19 06:15:50 2026-03-19 06:15:50 4. Substitution '\{}' in replacement argument is invalid, regexp has only {} capturing groups 4 Code: 36. DB::Exception: Substitution '\1' in replacement argument is invalid, regexp has only 0 capturing groups. (BAD_ARGUMENTS) (version 24.8.14.10526.altinitytest (altinity build)) (from [::1]:40898) (comment: 02864_replace_regexp_string_fallback.sql) (in query: -- negative tests 2026-03-19 06:15:50 -- Even if the fallback is used, invalid substitutions must throw an exception. 2026-03-19 06:15:50 SELECT 'Hello' AS haystack, 'l' AS needle, '\\1' AS replacement, replaceRegexpOne(materialize(haystack), needle, replacement);), Stack trace (when copying this message, always include the lines below): 2026-03-19 06:15:50 2026-03-19 06:15:50 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x00000000164a0872 2026-03-19 06:15:50 1. /build/src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000000c652179 2026-03-19 06:15:50 2. /build/contrib/llvm-project/libcxx/include/string:1499: DB::Exception::Exception(PreformattedMessage&&, int) @ 0x000000000701116c 2026-03-19 06:15:50 3. /build/contrib/llvm-project/libcxx/include/vector:438: DB::Exception::Exception(int, FormatStringHelperImpl::type, std::type_identity::type>, int&, int&&) @ 0x000000000b5827ab 2026-03-19 06:15:50 4. /build/src/Functions/ReplaceRegexpImpl.h:0: DB::ReplaceRegexpImpl::checkSubstitutions(std::basic_string_view>, int) @ 0x000000000b586eee 2026-03-19 06:15:50 5. /build/contrib/llvm-project/libcxx/include/string:1624: DB::FunctionStringReplace, DB::(anonymous namespace)::NameReplaceRegexpOne>::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000b583b51 2026-03-19 06:15:50 6. /build/src/Functions/IFunction.h:448: DB::IFunction::executeImplDryRun(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000701034a 2026-03-19 06:15:50 7. /build/src/Functions/IFunctionAdaptors.h:28: DB::FunctionToExecutableFunctionAdaptor::executeDryRunImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x00000000070269da 2026-03-19 06:15:50 8. /build/src/Functions/IFunction.cpp:0: DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b69c8f 2026-03-19 06:15:50 9. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b6a71a 2026-03-19 06:15:50 10. /build/src/Functions/IFunction.cpp:0: DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b6b645 2026-03-19 06:15:50 11. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::ActionsDAG::evaluatePartialResult(std::unordered_map, std::equal_to, std::allocator>>&, std::vector> const&, unsigned long, bool) @ 0x0000000010fdf321 2026-03-19 06:15:50 12. /build/src/Interpreters/ActionsDAG.cpp:0: DB::ActionsDAG::updateHeader(DB::Block const&) const @ 0x0000000010fde334 2026-03-19 06:15:50 13. /build/src/Processors/Transforms/ExpressionTransform.cpp:10: DB::ExpressionTransform::transformHeader(DB::Block const&, DB::ActionsDAG const&) @ 0x0000000012fc8fd2 2026-03-19 06:15:50 14. /build/src/Processors/QueryPlan/ExpressionStep.cpp:20: DB::ExpressionStep::ExpressionStep(DB::DataStream const&, DB::ActionsDAG) @ 0x000000001315c174 2026-03-19 06:15:50 15. /build/contrib/llvm-project/libcxx/include/vector:438: std::__unique_if::__unique_single std::make_unique[abi:v15007](DB::DataStream const&, DB::ActionsDAG&&) @ 0x00000000104d4d5a 2026-03-19 06:15:50 16. /build/src/Planner/Planner.cpp:0: DB::(anonymous namespace)::addExpressionStep(DB::QueryPlan&, std::shared_ptr&, String const&, std::unordered_set, std::hash>, std::equal_to>, std::allocator>>&) @ 0x000000001166911c 2026-03-19 06:15:50 17. /build/contrib/llvm-project/libcxx/include/string:1499: DB::Planner::buildPlanForQueryNode() @ 0x000000001166358a 2026-03-19 06:15:50 18. /build/src/Planner/Planner.cpp:0: DB::Planner::buildQueryPlanIfNeeded() @ 0x000000001165ea7e 2026-03-19 06:15:50 19. /build/src/Planner/Planner.h:44: DB::InterpreterSelectQueryAnalyzer::getQueryPlan() @ 0x000000001165cc6d 2026-03-19 06:15:50 20. /build/src/Interpreters/executeQuery.cpp:1182: DB::executeQueryImpl(char const*, char const*, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum, DB::ReadBuffer*) @ 0x0000000011925c4d 2026-03-19 06:15:50 21. /build/src/Interpreters/executeQuery.cpp:1397: DB::executeQuery(String const&, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum) @ 0x00000000119218bd 2026-03-19 06:15:50 22. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:612: DB::TCPHandler::runImpl() @ 0x0000000012cd099b 2026-03-19 06:15:50 23. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:593: DB::TCPHandler::run() @ 0x0000000012ce72d9 2026-03-19 06:15:50 24. /build/base/poco/Net/src/TCPServerConnection.cpp:57: Poco::Net::TCPServerConnection::start() @ 0x0000000016545e47 2026-03-19 06:15:50 25. /build/contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:48: Poco::Net::TCPServerDispatcher::run() @ 0x000000001654631e 2026-03-19 06:15:50 26. /build/base/poco/Foundation/src/ThreadPool.cpp:219: Poco::PooledThread::run() @ 0x00000000164f2b32 2026-03-19 06:15:50 27. /build/base/poco/Foundation/include/Poco/AutoPtr.h:77: Poco::ThreadImpl::runnableEntry(void*) @ 0x00000000164f0843 2026-03-19 06:15:50 28. ? @ 0x00007fac68332ac3 2026-03-19 06:15:50 29. ? @ 0x00007fac683c4850 2026-03-19 06:15:50 2026-03-19 06:15:50 message_format_string count() any_message 2026-03-19 06:15:50 2026-03-19 06:15:50 5. (from {}{}{}){}{} {} (stage: {}) 3 (from [::1]:57000) (comment: 02687_native_fuzz.sql) -- It correctly throws exception about incorrect data instead of a low-level exception about the allocator: 2026-03-19 06:15:50 SELECT * FROM format(Native, 'WatchID Int64, JavaEnable Int16, UTMCaTitle String, GoodEvent Int16, EventTime DateTime, EventDate Date, Countem String, FromTag String, HasGCLID Int16, RefererHash Int64, URLHash Int64, CLID Int16', $$ ��'�X+�'�X+�'�URLHashInt64�|3�b.�|3�b.�|3�b.�|3�b.� 2026-03-19 06:15:51 o�e� �#�\X-h�X v�v�h�9�D�|3�b.�CLIDInt32�$$); (stage: Complete) 2026-03-19 06:15:51 2026-03-19 06:15:51 2026-03-19 06:15:51 2026-03-19 06:15:51 Top short messages: 2026-03-19 06:15:51 2026-03-19 06:15:51 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-03-19 06:15:51 2026-03-19 06:15:51 1. 113 {} Code: 41. DB::Exception: Value 1 for year must be in the range [1970, 2106]: In scope SELECT parseDateTimeInJodaSyntax(' 26 2026-03-19 06:15:51 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-03-19 06:15:51 2026-03-19 06:15:51 2. 19 Creating {}: {} Creating table test_oowxg1wl_2.src: CREATE TABLE IF NOT EXISTS test_oowxg1wl_2.src UUID '30502c99-56b1-4988-96e4-7f7a473 124 2026-03-19 06:15:51 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-03-19 06:15:51 2026-03-19 06:15:51 3. 12 Froze {} parts Froze 10 parts -13 2026-03-19 06:15:51 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-03-19 06:15:51 2026-03-19 06:15:51 4. 6 Bad SSH public key provided Code: 706. DB::Exception: Bad SSH public key provided. (LIBSSH_ERROR) (version 24.8.14.10526.altinitytest (altinity buil 29 2026-03-19 06:15:51 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-03-19 06:15:51 2026-03-19 06:15:51 5. 4 Unknown data type family: {} Code: 50. DB::Exception: Unknown data type family: ab. (UNKNOWN_TYPE) (version 24.8.14.10526.altinitytest (altinity buil 29 2026-03-19 06:15:51 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-03-19 06:15:51 2026-03-19 06:15:51 6. 2 Unknown setting '{}' Code: 115. DB::Exception: Unknown setting 'xxx_yyy'. (UNKNOWN_SETTING) (version 24.8.14.10526.altinitytest (altinity bui 27 2026-03-19 06:15:51 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-03-19 06:15:51 2026-03-19 06:15:51 7. 2 Substitution {} is not set Code: 456. DB::Exception: Substitution `s` is not set. (UNKNOWN_QUERY_PARAMETER) (version 24.8.14.10526.altinitytest (al 29 2026-03-19 06:15:51 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-03-19 06:15:51 2026-03-19 06:15:51 8. 2 Unknown table engine {} Code: 56. DB::Exception: Unknown table engine s3. (UNKNOWN_STORAGE) (version 24.8.14.10526.altinitytest (altinity build) 24 2026-03-19 06:15:51 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-03-19 06:15:51 2026-03-19 06:15:51 9. 2 Invalid cache key hex: {} Code: 36. DB::Exception: Invalid cache key hex: kek. (BAD_ARGUMENTS) (version 24.8.14.10526.altinitytest (altinity build 27 2026-03-19 06:15:51 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-03-19 06:15:51 2026-03-19 06:15:51 10. 2 Table {} is not empty Code: 705. DB::Exception: Table tab2 is not empty. (TABLE_NOT_EMPTY) (version 24.8.14.10526.altinitytest (altinity build 25 2026-03-19 06:15:51 2026-03-19 06:15:51 2026-03-19 06:15:51 2026-03-19 06:15:51 Top messages by level: 2026-03-19 06:15:51 2026-03-19 06:15:51 (0.0007642514015993297,'Failed to push block to view {}, {}') Error 2026-03-19 06:15:51 (0.00028808818266048806,'Not enabled four letter command {}') Warning 2026-03-19 06:15:51 (0.0024531526471089594,'Fetching of part was cancelled') Information 2026-03-19 06:15:51 (0.040259065499804694,'(from {}{}{}){}{} {} (stage: {})') Debug 2026-03-19 06:15:51 (0.07366848849943168,'is disk {} eligible for search: {}') Trace 2026-03-19 06:15:51 2026-03-19 06:15:51 + set -e Files in current directory + echo 'Files in current directory' + ls -la ./ total 129400 drwxr-xr-x 1 root root 4096 Mar 19 06:08 . drwxr-xr-x 1 root root 4096 Mar 19 06:08 .. -rw-rw-r-- 1 1000 1000 119 Mar 19 05:33 analyzer_tech_debt.txt -rw-rw-r-- 1 root root 2380 Feb 1 2025 attach_gdb.lib -rw-r--r-- 1 root root 1834 Mar 19 06:04 __azurite_db_blob_extent__.json -rw-r--r-- 1 root root 4241 Mar 19 06:04 __azurite_db_blob__.json -rw-r--r-- 1 root root 2049616 Mar 19 06:15 azurite_log lrwxrwxrwx 1 root root 7 Sep 12 2024 bin -> usr/bin drwxr-xr-x 2 root root 4096 Mar 19 06:03 __blobstorage__ drwxr-xr-x 2 root root 4096 Apr 19 2022 boot -rw-rw-r-- 1 1000 1000 966 Mar 19 05:33 broken_tests.json drwxr-x--- 4 root root 4096 Mar 19 06:02 data drwxr-xr-x 14 root root 3840 Mar 19 05:41 dev -rwxr-xr-x 1 root root 0 Mar 19 05:41 .dockerenv drwxr-xr-x 1 root root 4096 Mar 19 05:42 etc drwxr-x--- 2 root root 4096 Mar 19 06:02 flags drwxr-x--- 2 root root 4096 Mar 19 06:02 format_schemas drwxr-xr-x 1 1000 1000 4096 Mar 19 05:42 hadoop-3.3.1 drwxr-xr-x 2 root root 4096 Apr 19 2022 home lrwxrwxrwx 1 root root 7 Sep 12 2024 lib -> usr/lib lrwxrwxrwx 1 root root 9 Sep 12 2024 lib32 -> usr/lib32 lrwxrwxrwx 1 root root 9 Sep 12 2024 lib64 -> usr/lib64 lrwxrwxrwx 1 root root 10 Sep 12 2024 libx32 -> usr/libx32 -rwxr-xr-x 1 root root 26927256 Feb 1 2025 mc drwxr-xr-x 2 root root 4096 Sep 12 2024 media drwxr-x--- 2 root root 4096 Mar 19 06:02 metadata drwxr-x--- 2 root root 4096 Mar 19 06:02 metadata_dropped -rwxr-xr-x 1 root root 103174296 Feb 1 2025 minio drwxr-xr-x 4 root root 4096 Mar 19 05:42 minio_data drwxr-xr-x 2 root root 4096 Sep 12 2024 mnt drwxr-xr-x 1 root root 4096 Feb 1 2025 opt -rw-r--r-- 1 root root 0 Feb 15 2024 .package-cache-mutate drwxrwxr-x 2 1000 1000 4096 Mar 19 05:41 package_folder drwxr-x--- 2 root root 4096 Mar 19 06:05 preprocessed_configs dr-xr-xr-x 314 root root 0 Mar 19 05:41 proc -rwxrwxr-x 1 root root 9627 Feb 1 2025 process_functional_tests_result.py -rw-r--r-- 1 root root 29 Mar 19 05:44 queries_02352 -rw-r----- 1 root root 1 Mar 19 06:02 quotas.list -rw-rw-r-- 1 root root 837 Feb 1 2025 requirements.txt -rw-r----- 1 root root 1 Mar 19 06:02 roles.list drwx------ 1 root root 4096 Mar 19 06:13 root -rw-r----- 1 root root 1 Mar 19 06:02 row_policies.list drwxr-xr-x 1 root root 4096 Mar 19 05:42 run -rwxrwxr-x 1 root root 22124 Feb 1 2025 run.sh lrwxrwxrwx 1 root root 8 Sep 12 2024 sbin -> usr/sbin -rw-r--r-- 1 root root 747 Mar 19 05:42 script.gdb -rw-r--r-- 1 root root 65817 Mar 19 06:06 server.log -rw-r----- 1 root root 1 Mar 19 06:02 settings_profiles.list -rwxrwxr-x 1 root root 10374 Feb 1 2025 setup_export_logs.sh -rwxrwxr-x 1 root root 360 Feb 1 2025 setup_hdfs_minicluster.sh -rwxrwxr-x 1 root root 3456 Feb 1 2025 setup_minio.sh drwxr-xr-x 2 root root 4096 Sep 12 2024 srv -rw-r--r-- 1 root root 399 Mar 19 05:44 ssh_key -rw-r----- 1 root root 65 Mar 19 06:05 status drwxr-x--- 4 root root 4096 Mar 19 06:02 store -rw-rw-r-- 1 root root 14015 Feb 1 2025 stress_tests.lib dr-xr-xr-x 13 root root 0 Mar 19 05:41 sys drwxrwxr-x 2 1000 1000 4096 Mar 19 05:42 test_output drwxrwxrwt 1 root root 4096 Mar 19 06:15 tmp drwxr-x--- 2 root root 4096 Mar 19 06:02 user_files -rw-r----- 1 root root 1 Mar 19 06:04 users.list drwxr-xr-x 1 root root 4096 Sep 12 2024 usr -rw-rw-r-- 1 root root 897 Feb 1 2025 utils.lib -rw-r----- 1 root root 36 Mar 19 06:02 uuid drwxr-xr-x 1 root root 4096 Sep 12 2024 var Files in root directory + echo 'Files in root directory' + ls -la / total 129400 drwxr-xr-x 1 root root 4096 Mar 19 06:08 . drwxr-xr-x 1 root root 4096 Mar 19 06:08 .. -rw-rw-r-- 1 1000 1000 119 Mar 19 05:33 analyzer_tech_debt.txt -rw-rw-r-- 1 root root 2380 Feb 1 2025 attach_gdb.lib -rw-r--r-- 1 root root 1834 Mar 19 06:04 __azurite_db_blob_extent__.json -rw-r--r-- 1 root root 4241 Mar 19 06:04 __azurite_db_blob__.json -rw-r--r-- 1 root root 2049616 Mar 19 06:15 azurite_log lrwxrwxrwx 1 root root 7 Sep 12 2024 bin -> usr/bin drwxr-xr-x 2 root root 4096 Mar 19 06:03 __blobstorage__ drwxr-xr-x 2 root root 4096 Apr 19 2022 boot -rw-rw-r-- 1 1000 1000 966 Mar 19 05:33 broken_tests.json drwxr-x--- 4 root root 4096 Mar 19 06:02 data drwxr-xr-x 14 root root 3840 Mar 19 05:41 dev -rwxr-xr-x 1 root root 0 Mar 19 05:41 .dockerenv drwxr-xr-x 1 root root 4096 Mar 19 05:42 etc drwxr-x--- 2 root root 4096 Mar 19 06:02 flags drwxr-x--- 2 root root 4096 Mar 19 06:02 format_schemas drwxr-xr-x 1 1000 1000 4096 Mar 19 05:42 hadoop-3.3.1 drwxr-xr-x 2 root root 4096 Apr 19 2022 home lrwxrwxrwx 1 root root 7 Sep 12 2024 lib -> usr/lib lrwxrwxrwx 1 root root 9 Sep 12 2024 lib32 -> usr/lib32 lrwxrwxrwx 1 root root 9 Sep 12 2024 lib64 -> usr/lib64 lrwxrwxrwx 1 root root 10 Sep 12 2024 libx32 -> usr/libx32 -rwxr-xr-x 1 root root 26927256 Feb 1 2025 mc drwxr-xr-x 2 root root 4096 Sep 12 2024 media drwxr-x--- 2 root root 4096 Mar 19 06:02 metadata drwxr-x--- 2 root root 4096 Mar 19 06:02 metadata_dropped -rwxr-xr-x 1 root root 103174296 Feb 1 2025 minio drwxr-xr-x 4 root root 4096 Mar 19 05:42 minio_data drwxr-xr-x 2 root root 4096 Sep 12 2024 mnt drwxr-xr-x 1 root root 4096 Feb 1 2025 opt -rw-r--r-- 1 root root 0 Feb 15 2024 .package-cache-mutate drwxrwxr-x 2 1000 1000 4096 Mar 19 05:41 package_folder drwxr-x--- 2 root root 4096 Mar 19 06:05 preprocessed_configs dr-xr-xr-x 314 root root 0 Mar 19 05:41 proc -rwxrwxr-x 1 root root 9627 Feb 1 2025 process_functional_tests_result.py -rw-r--r-- 1 root root 29 Mar 19 05:44 queries_02352 -rw-r----- 1 root root 1 Mar 19 06:02 quotas.list -rw-rw-r-- 1 root root 837 Feb 1 2025 requirements.txt -rw-r----- 1 root root 1 Mar 19 06:02 roles.list drwx------ 1 root root 4096 Mar 19 06:13 root -rw-r----- 1 root root 1 Mar 19 06:02 row_policies.list drwxr-xr-x 1 root root 4096 Mar 19 05:42 run -rwxrwxr-x 1 root root 22124 Feb 1 2025 run.sh lrwxrwxrwx 1 root root 8 Sep 12 2024 sbin -> usr/sbin -rw-r--r-- 1 root root 747 Mar 19 05:42 script.gdb -rw-r--r-- 1 root root 65817 Mar 19 06:06 server.log -rw-r----- 1 root root 1 Mar 19 06:02 settings_profiles.list -rwxrwxr-x 1 root root 10374 Feb 1 2025 setup_export_logs.sh -rwxrwxr-x 1 root root 360 Feb 1 2025 setup_hdfs_minicluster.sh -rwxrwxr-x 1 root root 3456 Feb 1 2025 setup_minio.sh drwxr-xr-x 2 root root 4096 Sep 12 2024 srv -rw-r--r-- 1 root root 399 Mar 19 05:44 ssh_key -rw-r----- 1 root root 65 Mar 19 06:05 status drwxr-x--- 4 root root 4096 Mar 19 06:02 store -rw-rw-r-- 1 root root 14015 Feb 1 2025 stress_tests.lib dr-xr-xr-x 13 root root 0 Mar 19 05:41 sys drwxrwxr-x 2 1000 1000 4096 Mar 19 05:42 test_output drwxrwxrwt 1 root root 4096 Mar 19 06:15 tmp drwxr-x--- 2 root root 4096 Mar 19 06:02 user_files -rw-r----- 1 root root 1 Mar 19 06:04 users.list drwxr-xr-x 1 root root 4096 Sep 12 2024 usr -rw-rw-r-- 1 root root 897 Feb 1 2025 utils.lib -rw-r----- 1 root root 36 Mar 19 06:02 uuid drwxr-xr-x 1 root root 4096 Sep 12 2024 var + /process_functional_tests_result.py 2026-03-19 06:15:51,729 File /analyzer_tech_debt.txt with broken tests found 2026-03-19 06:15:51,729 File /broken_tests.json with broken tests found 2026-03-19 06:15:51,730 Broken tests in the list: 4 2026-03-19 06:15:51,730 Find files in result folder test_result.txt,gdb.log,run.log,minio.log,hdfs_minicluster.log 2026-03-19 06:15:51,763 Is flaky check: False 2026-03-19 06:15:51,763 Result parsed 2026-03-19 06:15:51,772 Result written + clickhouse-client -q 'system flush logs' + stop_logs_replication + echo 'Detach all logs replication' Detach all logs replication + clickhouse-client --query 'select database||'\''.'\''||table from system.tables where database = '\''system'\'' and (table like '\''%_sender'\'' or table like '\''%_watcher'\'')' + tee /dev/stderr + timeout --preserve-status --signal TERM --kill-after 5m 15m xargs -n1 -r -i clickhouse-client --query 'drop table {}' xargs: warning: options --max-args and --replace/-I/-i are mutually exclusive, ignoring previous --max-args value + failed_to_save_logs=0 + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.query_log into outfile '\''/test_output/query_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.zookeeper_log into outfile '\''/test_output/zookeeper_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.trace_log into outfile '\''/test_output/trace_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.transactions_info_log into outfile '\''/test_output/transactions_info_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.metric_log into outfile '\''/test_output/metric_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.blob_storage_log into outfile '\''/test_output/blob_storage_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.error_log into outfile '\''/test_output/error_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + sleep 1 + clickhouse-client -q 'SYSTEM FLUSH ASYNC INSERT QUEUE' + clickhouse-client -q 'SELECT log FROM minio_audit_logs ORDER BY event_time INTO OUTFILE '\''/test_output/minio_audit_logs.jsonl.zst'\'' FORMAT JSONEachRow' + clickhouse-client -q 'SELECT log FROM minio_server_logs ORDER BY event_time INTO OUTFILE '\''/test_output/minio_server_logs.jsonl.zst'\'' FORMAT JSONEachRow' + sudo clickhouse stop script.gdb:13: Error in sourced command file: No stack. /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 606. The process with pid = 606 is running. Sent terminate signal to process with pid 606. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 606. The process with pid = 606 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 606. The process with pid = 606 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 606. The process with pid = 606 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 606. The process with pid = 606 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 606. The process with pid = 606 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 606. The process with pid = 606 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 606. The process with pid = 606 does not exist. Server stopped + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + kill 1491 + rg -Fa '' /var/log/clickhouse-server/clickhouse-server.log + : + rg -A50 -Fa ============ /var/log/clickhouse-server/stderr.log + : + data_path_config=--path=/var/lib/clickhouse/ + zstd --threads=0 + [[ -n '' ]] + '[' 0 -ne 0 ']' + for trace_type in CPU Memory Real + clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q ' select arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack, count(*) AS samples from system.trace_log where trace_type = '\''CPU'\'' group by trace order by samples desc settings allow_introspection_functions = 1 format TabSeparated' + zstd --threads=0 + for trace_type in CPU Memory Real + clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q ' select arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack, count(*) AS samples from system.trace_log where trace_type = '\''Memory'\'' group by trace order by samples desc settings allow_introspection_functions = 1 format TabSeparated' + zstd --threads=0 + for trace_type in CPU Memory Real + zstd --threads=0 + clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q ' select arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack, count(*) AS samples from system.trace_log where trace_type = '\''Real'\'' group by trace order by samples desc settings allow_introspection_functions = 1 format TabSeparated' + check_logs_for_critical_errors + sed -n '/WARNING:.*anitizer/,/^$/p' /var/log/clickhouse-server/stderr.log + rg -Fav -e 'ASan doesn'\''t fully support makecontext/swapcontext functions' -e DB::Exception /test_output/tmp + echo -e 'No sanitizer asserts\tOK\t\N\t' + rm -f /test_output/tmp + rg -Fa ' Application: Child process was terminated by signal 9' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + echo -e 'No OOM messages in clickhouse-server.log\tOK\t\N\t' + rg -Fa 'Code: 49. DB::Exception: ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + echo -e 'No logical errors\tOK\t\N\t' + '[' -s /test_output/logical_errors.txt ']' + rm /test_output/logical_errors.txt + grep -v a.myext + rg --text 'Code: 499.*The specified key does not exist' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + echo -e 'No lost s3 keys\tOK\t\N\t' + rg -Fa 'it is lost forever' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + grep SharedMergeTreePartCheckThread + echo -e 'No SharedMergeTree lost forever in clickhouse-server.log\tOK\t\N\t' + '[' -s /test_output/no_such_key_errors.txt ']' + rm /test_output/no_such_key_errors.txt + rg -Fa '########################################' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + echo -e 'Not crashed\tOK\t\N\t' + rg -Fa ' ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + echo -e 'No fatal messages in clickhouse-server.log\tOK\t\N\t' + '[' -s /test_output/fatal_messages.txt ']' + rm /test_output/fatal_messages.txt + rg -Faz '########################################' /test_output/blob_storage_log.tsv.zst /test_output/check_status.tsv /test_output/clickhouse-server.log.zst /test_output/error_log.tsv.zst /test_output/gdb.log /test_output/hdfs_minicluster.log /test_output/metric_log.tsv.zst /test_output/minio_audit_logs.jsonl.zst /test_output/minio.log /test_output/minio_server_logs.jsonl.zst /test_output/query_log.tsv.zst /test_output/run.log /test_output/test_results.tsv /test_output/test_result.txt /test_output/trace-log-CPU-flamegraph.tsv.zst /test_output/trace-log-Memory-flamegraph.tsv.zst /test_output/trace-log-Real-flamegraph.tsv.zst /test_output/trace_log.tsv.zst /test_output/transactions_info_log.tsv.zst /test_output/zookeeper_log.tsv.zst + rg -Fa ' received signal ' /test_output/gdb.log + dmesg -T + grep -q -F -e 'Out of memory: Killed process' -e 'oom_reaper: reaped process' -e oom-kill:constraint=CONSTRAINT_NONE /test_output/dmesg.log + echo -e 'No OOM in dmesg\tOK\t\N\t' + rm /var/log/clickhouse-server/clickhouse-server.log + mv /var/log/clickhouse-server/stderr.log /test_output/ + [[ -n '' ]] + tar -chf /test_output/coordination.tar /var/lib/clickhouse/coordination tar: Removing leading `/' from member names tar: Removing leading `/' from hard link targets + rm -rf /var/lib/clickhouse/data/system/asynchronous_insert_log/ /var/lib/clickhouse/data/system/asynchronous_metric_log/ /var/lib/clickhouse/data/system/backup_log/ /var/lib/clickhouse/data/system/blob_storage_log/ /var/lib/clickhouse/data/system/crash_log/ /var/lib/clickhouse/data/system/error_log/ /var/lib/clickhouse/data/system/filesystem_cache_log/ /var/lib/clickhouse/data/system/metric_log/ /var/lib/clickhouse/data/system/opentelemetry_span_log/ /var/lib/clickhouse/data/system/part_log/ /var/lib/clickhouse/data/system/processors_profile_log/ /var/lib/clickhouse/data/system/query_log/ /var/lib/clickhouse/data/system/query_thread_log/ /var/lib/clickhouse/data/system/query_views_log/ /var/lib/clickhouse/data/system/s3queue_log/ /var/lib/clickhouse/data/system/session_log/ /var/lib/clickhouse/data/system/text_log/ /var/lib/clickhouse/data/system/trace_log/ /var/lib/clickhouse/data/system/transactions_info_log/ /var/lib/clickhouse/data/system/zookeeper_log/ + tar -chf /test_output/store.tar /var/lib/clickhouse/store tar: Removing leading `/' from member names tar: Removing leading `/' from hard link targets + tar -chf /test_output/metadata.tar /var/lib/clickhouse/metadata/03147_db.sql /var/lib/clickhouse/metadata/default.sql /var/lib/clickhouse/metadata/empty_db_01036.sql /var/lib/clickhouse/metadata/information_schema.sql /var/lib/clickhouse/metadata/INFORMATION_SCHEMA.sql /var/lib/clickhouse/metadata/system.sql /var/lib/clickhouse/metadata/test_7umr486f.sql /var/lib/clickhouse/metadata/test_bl29x3l8_1.sql /var/lib/clickhouse/metadata/test_cjzcouni.sql /var/lib/clickhouse/metadata/test.sql /var/lib/clickhouse/metadata/test_zgbj67ze.sql tar: Removing leading `/' from member names tar: Removing leading `/' from hard link targets + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + collect_core_dumps + find . -type f -maxdepth 1 -name 'core.*' + read -r core